Overview

  • Product name

  • Description

    Rabbit polyclonal to ABHD14B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human ABHD14B aa 2-210.
    Sequence:

    AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNL GTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALE LGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVK TPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTG LLDFLQGLQ


    Database link: Q96IU4

  • Positive control

    • WB: Mouse small intestine, spleen, liver and lung lysates. IHC-P: Human liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.

Target

  • Function

    Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.
  • Tissue specificity

    Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. ABHD14 family.
  • Cellular localization

    Cytoplasm. Nucleus. Predominantly cytoplasmic.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABHD14B antibody
    • ABHEB_HUMAN antibody
    • Abhydrolase domain containing 14B antibody
    • Abhydrolase domain containing protein 14B antibody
    • Abhydrolase domain-containing protein 14B antibody
    • CCG1 interacting factor B antibody
    • CCG1-interacting factor B antibody
    • Cell cycle gene 1 interacting factor B antibody
    • CIB antibody
    • MGC15429 antibody
    • OTTHUMP00000212469 antibody
    see all

Images

  • All lanes : Anti-ABHD14B antibody (ab235436) at 1/500 dilution

    Lane 1 : Mouse small intestine lysate
    Lane 2 : Mouse spleen lysate
    Lane 3 : Mouse liver lysate
    Lane 4 : Mouse lung lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 22 kDa

  • Paraffin-embedded human liver tissue stained for ABHD14B using ab235436 at 1/100 dilution in immunohistochemical analysis.

References

ab235436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up