Overview

  • Product name

  • Description

    Rabbit polyclonal to Abi-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Abi-1 aa 1-182. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEET KAYTTQSLASVAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIH KEKVARREIGILTTNKNTSRTHKIIAPANMERPVRYIRKPIDYTVLDDVG HGVKWLKAKHGNNQPARTGTLSRTNPPTQKPP


    Database link: Q8IZP0

  • Positive control

    • IHC-P: Human stomach, prostate cancer, cerebrum, glioma, kidney and stomach cancer tissues. WB: Human lung lysate; Pig cerebrum, liver and small intestine lysates; Recombinant human Abi-1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 55 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May act in negative regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. May play a role in regulation of EGF-induced Erk pathway activation. Involved in cytoskeletal reorganization and EGFR signaling. Together with EPS8 participates in transduction of signals from Ras to Rac. In vitro, a trimeric complex of ABI1, EPS8 and SOS1 exhibits Rac specific guanine nucleotide exchange factor (GEF) activity and ABI1 seems to act as an adapter in the complex. Regulates ABL1/c-Abl-mediated phosphorylation of ENAH. Recruits WASF1 to lamellipodia and there seems to regulate WASF1 protein level.
  • Tissue specificity

    Widely expressed, with highest expression in brain.
  • Involvement in disease

    Note=A chromosomal aberration involving ABI1 is a cause of acute leukemias. Translocation t(10;11)(p11.2;q23) with MLL. ABI1 isoform 2 was found to be present in acute leukemia MLL-ABI1 fusion transcript.
  • Sequence similarities

    Belongs to the ABI family.
    Contains 1 SH3 domain.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Domain

    The t-SNARE coiled-coil homology domain is necessary and sufficient for interaction with STX1A.
  • Post-translational
    modifications

    In vitro substrate for v-Abl (By similarity). Phosphorylated on tyrosine residues after serum stimulation or induction by v-Abl.
  • Cellular localization

    Cytoplasm. Nucleus. Cell projection > lamellipodium. Cell projection > filopodium. Cell projection > growth cone. Cell junction > synapse > synaptosome. Cytoplasm > cytoskeleton. Localized to protruding lamellipodia and filopodia tips. Also localized to neuronal growth cones and synaptosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Abelson interactor 1 antibody
    • Abi-1 antibody
    • Abi1 antibody
    • ABI1_HUMAN antibody
    • Abl binding protein 4 antibody
    • Abl interactor 1 antibody
    • Abl interactor protein 1 antibody
    • Abl-binding protein 4 antibody
    • AblBP4 antibody
    • e3B1 antibody
    • Eps8 binding protein antibody
    • Eps8 SH3 domain binding protein antibody
    • Eps8 SH3 domain-binding protein antibody
    • Eps8-binding protein antibody
    • Hssh3bp1 antibody
    • Interactor protein AblBP4 antibody
    • NAP1 antibody
    • Nap1 binding protein antibody
    • Nap1-binding protein antibody
    • Nap1BP antibody
    • Spectrin SH3 domain binding protein 1 antibody
    • Spectrin SH3 domain-binding protein 1 antibody
    • SSH3BP antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for Abi-1 using ab233412 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Abi-1 using ab233412 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for Abi-1 using ab233412 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Abi-1 using ab233412 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Abi-1 using ab233412 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for Abi-1 using ab233412 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Abi-1 antibody (ab233412) at 2 µg/ml + Recombinant human Abi-1 protein

    Predicted band size: 55 kDa

  • All lanes : Anti-Abi-1 antibody (ab233412) at 1 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : Pig cerebrum tissue lysate
    Lane 3 : Pig liver tissue lysate
    Lane 4 : Pig small intestine tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 55 kDa

References

ab233412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up