Overview

  • Product name

  • Description

    Rabbit polyclonal to ABI2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ABI2 aa 311-361.
    Sequence:

    PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRH T


    Database link: Q9NYB9

  • Positive control

    • WB: RT-4 cell lysate. ICC/IF: MCF-7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 56 kDa.

Target

  • Function

    May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA.
  • Sequence similarities

    Belongs to the ABI family.
    Contains 1 SH3 domain.
    Contains 1 t-SNARE coiled-coil homology domain.
  • Post-translational
    modifications

    Is a substrate for ABL1.
  • Cellular localization

    Cytoplasm and Cell projection > lamellipodium. Cell projection > filopodium. Cytoplasm > cytoskeleton. Isoform 1 but not isoform 3 is localized to protruding lamellipodia and filopodia tips.
  • Information by UniProt
  • Database links

  • Alternative names

    • Abelson interactor 2 antibody
    • ABI 2 antibody
    • Abi-2 antibody
    • ABI2 antibody
    • ABI2_HUMAN antibody
    • ABI2B antibody
    • Abl binding protein 3 antibody
    • Abl interacting protein 1 (SH3 containing protein) antibody
    • Abl interactor 2 antibody
    • Abl interactor protein 2b antibody
    • Abl-binding protein 3 antibody
    • AblBP3 antibody
    • AIP 1 antibody
    • Arg binding protein 1 antibody
    • Arg protein tyrosine kinase binding protein antibody
    • Arg-binding protein 1 antibody
    • ArgBP1 antibody
    • ARGBPIA antibody
    • ArgBPIB antibody
    • OTTHUMP00000163783 antibody
    • OTTHUMP00000163784 antibody
    • OTTHUMP00000206182 antibody
    • OTTHUMP00000206183 antibody
    • OTTHUMP00000206184 antibody
    • OTTHUMP00000206185 antibody
    • SSH3BP2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF-7 cells labeling ABI2 with ab221177 at 4 µg/mL (green). 

  • Anti-ABI2 antibody (ab221177) at 1/500 dilution + RT-4 cell lysate

    Predicted band size: 56 kDa

References

ab221177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up