Anti-ABI2 antibody (ab247179)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ABI2 antibody
See all ABI2 primary antibodies -
Description
Rabbit polyclonal to ABI2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ABI2 aa 97-147.
Sequence:PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRH T
Database link: Q13802 -
Positive control
- IHC-P: Human cerebral cortex tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247179 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. -
Sequence similarities
Belongs to the ABI family.
Contains 1 SH3 domain.
Contains 1 t-SNARE coiled-coil homology domain. -
Post-translational
modificationsIs a substrate for ABL1. -
Cellular localization
Cytoplasm and Cell projection > lamellipodium. Cell projection > filopodium. Cytoplasm > cytoskeleton. Isoform 1 but not isoform 3 is localized to protruding lamellipodia and filopodia tips. - Information by UniProt
-
Database links
- Entrez Gene: 10152 Human
- Omim: 606442 Human
- SwissProt: Q9NYB9 Human
- Unigene: 471156 Human
-
Alternative names
- Abelson interactor 2 antibody
- ABI 2 antibody
- Abi-2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABI2 antibody (ab247179)Paraffin-embedded human cerebral cortex tissue stained for ABI2 using ab247179 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABI2 antibody (ab247179)Paraffin-embedded human pancreas tissue stained for ABI2 using ab247179 at 1/200 dilution in immunohistochemical analysis. Low expression as expected.
Datasheets and documents
References
ab247179 has not yet been referenced specifically in any publications.
