Anti-ABI2 antibody (ab247179)
Key features and details
- Rabbit polyclonal to ABI2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ABI2 antibody
See all ABI2 primary antibodies -
Description
Rabbit polyclonal to ABI2 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ABI2 aa 97-147.
Sequence:PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRH T
Database link: Q13802 -
Positive control
- IHC-P: Human cerebral cortex tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247179 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. -
Sequence similarities
Belongs to the ABI family.
Contains 1 SH3 domain.
Contains 1 t-SNARE coiled-coil homology domain. -
Post-translational
modificationsIs a substrate for ABL1. -
Cellular localization
Cytoplasm and Cell projection > lamellipodium. Cell projection > filopodium. Cytoplasm > cytoskeleton. Isoform 1 but not isoform 3 is localized to protruding lamellipodia and filopodia tips. - Information by UniProt
-
Database links
- Entrez Gene: 10152 Human
- Omim: 606442 Human
- SwissProt: Q9NYB9 Human
- Unigene: 471156 Human
-
Alternative names
- Abelson interactor 2 antibody
- ABI 2 antibody
- Abi-2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABI2 antibody (ab247179)Paraffin-embedded human cerebral cortex tissue stained for ABI2 using ab247179 at 1/200 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABI2 antibody (ab247179)Paraffin-embedded human pancreas tissue stained for ABI2 using ab247179 at 1/200 dilution in immunohistochemical analysis. Low expression as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247179 has not yet been referenced specifically in any publications.
