Overview

  • Product name

  • Description

    Rabbit polyclonal to ABI3BP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ABI3BP aa 205-306.
    Sequence:

    VEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQDHTVPAYVPRKLIPITIIK QVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMFEISD AL


    Database link: Q7Z7G0

  • Positive control

    • Human lymph node tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Expressed in brain, heart, lung, liver, pancreas kidney and placenta.
  • Sequence similarities

    Contains 2 fibronectin type-III domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABI gene family member 3 (NESH) binding protein antibody
    • ABI gene family member 3 binding protein antibody
    • ABI gene family member 3-binding protein antibody
    • ABI3BP antibody
    • FLJ41743 antibody
    • FLJ41754 antibody
    • Nesh binding protein antibody
    • Nesh BP antibody
    • Nesh-binding protein antibody
    • NeshBP antibody
    • Target of Nesh SH3 antibody
    • Target of Nesh-SH3 antibody
    • Tarsh antibody
    • TARSH_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling ABI3BP with ab187899 at 1/50 dilution.

References

ab187899 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up