Anti-ABP1 antibody (ab231147)
Key features and details
- Rabbit polyclonal to ABP1
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Pig
- Isotype: IgG
Overview
-
Product name
Anti-ABP1 antibody
See all ABP1 primary antibodies -
Description
Rabbit polyclonal to ABP1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Pig -
Immunogen
Recombinant fragment (His-tag) corresponding to Pig ABP1 aa 27-113. (Expressed in E.coli).
Sequence:SPRTPGGKAGVFADLSAQELKAVHSFLWSQKELKLEPSGTLTMAKNSVFL IEMLLPKKQHVLKFLDKGHRRPVREARAVIFFGAQEQ
Database link: Q9TRC7 -
Positive control
- WB: Recombinant pig ABP1 protein; Mouse placenta and small intestine lysates; Pig serum and kidney lysates. IHC-P: Pig liver, heart, kidney, stomach, and pancreas tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231147 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab231147 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 85 kDa. |
Target
-
Function
Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function. -
Tissue specificity
Placenta and kidney. -
Sequence similarities
Belongs to the copper/topaquinone oxidase family. -
Post-translational
modificationsTopaquinone (TPQ) is generated by copper-dependent autoxidation of a specific tyrosyl residue. -
Cellular localization
Secreted > extracellular space. - Information by UniProt
-
Database links
- Entrez Gene: 76507 Mouse
- Entrez Gene: 100517436 Pig
- SwissProt: Q8JZQ5 Mouse
- SwissProt: Q9TRC7 Pig
- Unigene: 213898 Mouse
-
Alternative names
- ABP antibody
- Abp1 antibody
- ABP1_HUMAN antibody
see all
Images
-
Anti-ABP1 antibody (ab231147) at 2 µg/ml + Pig kidney lysate
Predicted band size: 85 kDa -
Anti-ABP1 antibody (ab231147) at 2 µg/ml + Pig serum
Predicted band size: 85 kDa -
Anti-ABP1 antibody (ab231147) at 2 µg/ml + Mouse placenta lysate
Predicted band size: 85 kDa -
Anti-ABP1 antibody (ab231147) at 2 µg/ml + Pig small intestine lysate
Predicted band size: 85 kDa -
Anti-ABP1 antibody (ab231147) at 2 µg + Mouse small intestine lysate
Predicted band size: 85 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)
Formalin-fixed, paraffin-embedded pig liver tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)
Paraffin-embedded pig heart tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)
Paraffin-embedded pig kidney tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)
Paraffin-embedded pig stomach tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)
Paraffin-embedded pig pancreas tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Anti-ABP1 antibody (ab231147) at 2 µg/ml + Recombinant pig ABP1 protein
Predicted band size: 85 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231147 has not yet been referenced specifically in any publications.