Anti-ABP1 antibody (ab231147)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ABP1 antibody
See all ABP1 primary antibodies -
Description
Rabbit polyclonal to ABP1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Pig -
Immunogen
Recombinant fragment (His-tag) corresponding to Pig ABP1 aa 27-113. (Expressed in E.coli).
Sequence:SPRTPGGKAGVFADLSAQELKAVHSFLWSQKELKLEPSGTLTMAKNSVFL IEMLLPKKQHVLKFLDKGHRRPVREARAVIFFGAQEQ
Database link: Q9TRC7 -
Positive control
- WB: Recombinant pig ABP1 protein; Mouse placenta and small intestine lysates; Pig serum and kidney lysates. IHC-P: Pig liver, heart, kidney, stomach, and pancreas tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab231147 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231147 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 85 kDa. |
Target
-
Function
Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function. -
Tissue specificity
Placenta and kidney. -
Sequence similarities
Belongs to the copper/topaquinone oxidase family. -
Post-translational
modificationsTopaquinone (TPQ) is generated by copper-dependent autoxidation of a specific tyrosyl residue. -
Cellular localization
Secreted > extracellular space. - Information by UniProt
-
Database links
- Entrez Gene: 76507 Mouse
- Entrez Gene: 100517436 Pig
- SwissProt: Q8JZQ5 Mouse
- SwissProt: Q9TRC7 Pig
- Unigene: 213898 Mouse
-
Alternative names
- ABP antibody
- Abp1 antibody
- ABP1_HUMAN antibody
see all
Images
-
Western blot - Anti-ABP1 antibody (ab231147)Anti-ABP1 antibody (ab231147) at 2 µg/ml + Pig kidney lysate
Predicted band size: 85 kDa -
Western blot - Anti-ABP1 antibody (ab231147)Anti-ABP1 antibody (ab231147) at 2 µg/ml + Pig serum
Predicted band size: 85 kDa -
Western blot - Anti-ABP1 antibody (ab231147)Anti-ABP1 antibody (ab231147) at 2 µg/ml + Mouse placenta lysate
Predicted band size: 85 kDa -
Western blot - Anti-ABP1 antibody (ab231147)Anti-ABP1 antibody (ab231147) at 2 µg/ml + Pig small intestine lysate
Predicted band size: 85 kDa -
Western blot - Anti-ABP1 antibody (ab231147)Anti-ABP1 antibody (ab231147) at 2 µg + Mouse small intestine lysate
Predicted band size: 85 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)Formalin-fixed, paraffin-embedded pig liver tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)Paraffin-embedded pig heart tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)Paraffin-embedded pig kidney tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)Paraffin-embedded pig stomach tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ABP1 antibody (ab231147)Paraffin-embedded pig pancreas tissue stained for ABP1 with ab231147 at 20 μg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-ABP1 antibody (ab231147)Anti-ABP1 antibody (ab231147) at 2 µg/ml + Recombinant pig ABP1 protein
Predicted band size: 85 kDa
Datasheets and documents
References
ab231147 has not yet been referenced specifically in any publications.
