Overview

  • Product name

  • Description

    Rabbit polyclonal to ABP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse ABP1 aa 292-460. (Expressed in E.coli).
    Sequence:

    HTPVTVAGPHVVQPSGPRYKLEGNVVLYGDWSFSYRLRSSSGLQIFNVLF GGERVAYEVSVQEAVALYGGHTPAGMQTKYIDVGWGLGSVTHELAPGIDC PETATFLDAFHYYDSDGPVLYPRALCLFEMPTGVPLRRHFDSNFKGGFNF YAGLKGYVLVLRTTSTVYN


    Database link: Q8JZQ5

  • Positive control

    • WB: Mouse placenta lysate; Recombinant mouse ABP1 protein. IHC-P: Mouse intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231541 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 85 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.
  • Tissue specificity

    Placenta and kidney.
  • Sequence similarities

    Belongs to the copper/topaquinone oxidase family.
  • Post-translational
    modifications

    Topaquinone (TPQ) is generated by copper-dependent autoxidation of a specific tyrosyl residue.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABP antibody
    • Abp1 antibody
    • ABP1_HUMAN antibody
    • Amiloride binding protein 1 (amine oxidase (copper containing)) antibody
    • Amiloride binding protein 1 antibody
    • Amiloride binding protein antibody
    • Amiloride sensitive amine oxidase antibody
    • Amiloride-binding protein antibody
    • Amiloride-sensitive amine oxidase [copper-containing] antibody
    • Amine oxidase copper domain containing protein 1 antibody
    • AOC1 antibody
    • DAO antibody
    • DAO1 antibody
    • Diamine oxidase antibody
    • Histaminase antibody
    • KAO antibody
    • Kidney amine oxidase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse intestine tissue stained for ABP1 using ab231541 at 20 µg/ml in immunohistochemical analysis.

  • Anti-ABP1 antibody (ab231541) at 2 µg/ml + Recombinant mouse ABP1 protein

    Predicted band size: 85 kDa

  • Anti-ABP1 antibody (ab231541) at 2 µg/ml + Mouse placenta lysate

    Predicted band size: 85 kDa

References

ab231541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up