Overview

  • Product name
    Anti-ACAA1/Beta-ketothiolase antibody
    See all ACAA1/Beta-ketothiolase primary antibodies
  • Description
    Rabbit polyclonal to ACAA1/Beta-ketothiolase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human ACAA1/Beta-ketothiolase aa 72-199.
    Sequence:

    VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNR QCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEK EKARDCLIPMGITSENVAERFGISREKQ


    Database link: P09110

  • Positive control
    • WB: RT4 and U-251 cell lysates; plasma, liver and tonsil tissue lysates IHC-P: Human colon, kidney, liver and pancreas tissue. ICC/IF: U-251 MG cells.
  • General notes

     This product was previously labelled as ACAA1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 44 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-ACAA1/Beta-ketothiolase antibody (ab224235) at 0.4 µg/ml

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 44 kDa

  • Immunohistochemical analysis of human pancreas labeling ACAA1/Beta-ketothiolase with ab224235 at 1/50.

     

  • Immunohistochemical analysis of human liver labeling ACAA1/Beta-ketothiolase with ab224235 at 1/50.

  • All lanes : Anti-ACAA1/Beta-ketothiolase antibody (ab224235) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat Wistar bladder tumor cell line) cell lysate

    Predicted band size: 44 kDa

  • Immunohistochemical analysis of human kidney labeling ACAA1/Beta-ketothiolase with ab224235 at 1/50.

  • Immunohistochemical analysis of human colon labeling ACAA1/Beta-ketothiolase with ab224235 at 1/50.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for ACAA1/Beta-ketothiolase (green) using ab224235 (4 µg/ml) in ICC/IF.

References

ab224235 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up