Overview

  • Product name

    Anti-ACAA1/Beta-ketothiolase antibody [CL2650]
    See all ACAA1/Beta-ketothiolase primary antibodies
  • Description

    Mouse monoclonal [CL2650] to ACAA1/Beta-ketothiolase
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human ACAA1/Beta-ketothiolase aa 72-199.
    Sequence:

    VLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNR QCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEK EKARDCLIPMGITSENVAERFGISREKQ


    Database link: P09110

  • Epitope

    Binds to an epitope located within the peptide sequence GAIMARIAQFLSDIP as determined by overlapping synthetic peptides.
  • Positive control

    • IHC-P: Human colon, liver, kidney and prostate tissues. WB: U-251 Cells ICC/IF: CACO-2
  • General notes

     This product was previously labelled as ACAA1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab210961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 44 kDa.

Target

Images

  • Anti-ACAA1/Beta-ketothiolase antibody [CL2650] (ab210961) at 1/500 dilution + U251 cells

    Predicted band size: 44 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate tissue labeling ACAA1/Beta-ketothiolase with ab210961 at 1/200 dilution.

  • Immunocytochemistry/Immunofluourescent analysis of CACO-2 cells staining ACAA1 with ab210961 at 1µg/ml (green). Microtubule (red) and nuclear (blue) probes were used.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human kidney tissue labeling ACAA1/Beta-ketothiolase with ab210961 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human liver tissue labeling ACAA1/Beta-ketothiolase with ab210961 at 1/200 dilution.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human colon tissue labeling ACAA1/Beta-ketothiolase with ab210961 at 1/200 dilution.

References

ab210961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up