Overview

  • Product name

  • Description

    Mouse polyclonal to ACAD11
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human ACAD11 aa 678-780. (NP_115545).
    Sequence:

    RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQ VCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLT AKI


    Database link: Q709F0

  • Positive control

    • MES-SA/Dx5 cell lysate; Recombinant Human ACAD11 fragment (immunogen).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 87 kDa.

Target

Images

  • Anti-ACAD11 antibody (ab194499) at 1/500 dilution + MES-SA/Dx5 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 87 kDa

  • Anti-ACAD11 antibody (ab194499) at 1/1000 dilution + Recombinant Human ACAD11 fragment (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 87 kDa



    Predicted MWt of immunogen: 37.44 kDa.

References

ab194499 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up