Overview

  • Product name

  • Description

    Rabbit polyclonal to ACAD9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ACAD9 aa 62-143.
    Sequence:

    DELNEINQFLGPVEKFFTEEVDSRKIDQEGKIPDETLEKLKSLGLFGLQV PEEYGGLGFSNTMYSRLGEIISMDGSITVTLA


    Database link: Q9H845

  • Positive control

    • RT-4 and U-251 MG cell lysates; Human liver lysate; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220386 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 69 kDa.

Target

  • Relevance

    ACAD9 belongs to a group of Acyl CoA dehydrogenases (ACADs). This family of proteins localize to the mitochondria and catalyze the rate-limiting step in the beta-oxidation of fatty acyl-CoA. One of the main energy producing metabolic pathways in eukaryotes is mitochondrial fatty acid beta oxidation. ACADs act on fatty acids containing 14 to 20 carbons. ACAD9 is specifically active toward palmitoyl-CoA and long-chain unsaturated substrates. Mutations in this gene cause acyl-CoA dehydrogenase family member type 9 deficiency. Alternate splicing results in multiple transcript variants.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • Acyl CoA dehydrogenase 9 antibody
    • Acyl Coenzyme A dehydrogenase family, member 9 antibody
    • acyl-CoA dehydrogenase family member 9, mitochondrial antibody
    • FLJ23533 antibody
    • MGC14452 antibody
    • NPD002 antibody
    • Very long chain acyl CoA dehydrogenase VLCAD antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling ACAD9 with ab220386 at 4 µg/ml (green).

  • All lanes : Anti-ACAD9 antibody (ab220386) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 69 kDa

References

ab220386 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220386.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up