Overview

  • Product name

  • Description

    Rabbit polyclonal to ACADL/LCAD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to Human ACADL/LCAD aa 288-337 (internal sequence).
    Sequence:

    LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL


    Database link: NP_001599

  • Positive control

    • Placental lysate
  • General notes

    Previously labelled as ACADL. 

Properties

Applications

Our Abpromise guarantee covers the use of ab82853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Pathway

    Lipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in disease

    Defects in ACADL are a cause of acyl-CoA dehydrogenase very long-chain deficiency (ACADVLD) [MIM:201475]. An inborn error of mitochondrial fatty acid beta-oxidation which leads to impaired long-chain fatty acid beta-oxidation. It is clinically heterogeneous, with three major phenotypes: a severe childhood form characterized by early onset, high mortality and high incidence of cardiomyopathy; a milder childhood form with later onset, characterized by hypoketotic hypoglycemia, low mortality and rare cardiomyopathy; an adult form, with isolated skeletal muscle involvement, rhabdomyolysis and myoglobinuria, usually triggered by exercise or fasting.
  • Sequence similarities

    Belongs to the acyl-CoA dehydrogenase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACAD4 antibody
    • ACADL antibody
    • ACADL_HUMAN antibody
    • Acyl Coenzyme A dehydrogenase long chain antibody
    • Acyl-CoA dehydrogenase long chain antibody
    • FLJ94052 antibody
    • LCAD antibody
    • Long chain acyl CoA dehydrogenase antibody
    • Long-chain specific acyl-CoA dehydrogenase, mitochondrial antibody
    see all

Images

  • Anti-ACADL/LCAD antibody (ab82853) at 1 µg/ml (in 5% skim milk / PBS buffer) + placental lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 48 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 24 kDa. We are unsure as to the identity of these extra bands.



    Gel Concentration 12%

References

This product has been referenced in:

  • Svensson K  et al. Temporal overexpression of SIRT1 in skeletal muscle of adult mice does not improve insulin sensitivity or markers of mitochondrial biogenesis. Acta Physiol (Oxf) N/A:N/A (2017). Read more (PubMed: 28544355) »
  • LaBarge SA  et al. p300 is not required for metabolic adaptation to endurance exercise training. FASEB J 30:1623-33 (2016). Read more (PubMed: 26712218) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab82853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up