Overview

  • Product name

    Anti-ACAP1 antibody
  • Description

    Rabbit polyclonal to ACAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human ACAP1 aa 1-266.
    Sequence:

    MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGR HYLAASRAFVVGICDLARLGPPEPMMAECLEKFTVSLNHKLDSHAELLDA TQHTLQQQIQTLVKEGLRGFREARRDFWRGAESLEAALTHNAEVPRRRAQ EAEEAGAALRTARAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQA THFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKEL GGEEPEPSLREGPGGL


    Database link: Q15027

  • Positive control

    • WB: Mouse lung lysate; Jurkat and K562 whole cell lysates. IHC-P: Human lung and pancreatic tissue.
  • General notes

     This product was previously labelled as CENTB1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 82 kDa.

Target

  • Function

    GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface.
  • Tissue specificity

    Highest level in lung and spleen. Low level in heart, kidney, liver and pancreas.
  • Sequence similarities

    Contains 3 ANK repeats.
    Contains 1 Arf-GAP domain.
    Contains 1 BAR domain.
    Contains 1 PH domain.
  • Domain

    PH domain binds phospholipids including phosphatidic acid, phosphatidylinositol 3-phosphate, phosphatidylinositol 3,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3). May mediate ACAP1-binding to PIP2 or PIP3 containing membranes.
  • Post-translational
    modifications

    Phosphorylation at Ser-554 by PKB is required for interaction with ITGB1, export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACAP 1 antibody
    • ACAP1 antibody
    • ACAP1_HUMAN antibody
    • Arf GAP with coiled coil ANK repeat and PH domains 1 antibody
    • Arf GAP with coiled coil, ankyrin repeat, and pleckstrin homology domains 1 antibody
    • Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 antibody
    • ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 antibody
    • CENT B1 antibody
    • Centaurin beta 1 antibody
    • Centaurin-beta-1 antibody
    • CENTB 1 antibody
    • Cnt b1 antibody
    • Cnt-b1 antibody
    • Cntb1 antibody
    • KIAA0050 antibody
    see all

Images

  • All lanes : Anti-ACAP1 antibody (ab235827) at 1/1000 dilution

    Lane 1 : Mouse lung tissue lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 82 kDa

  • Paraffin-embedded human lung tissue stained for ACAP1 using ab235827 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for ACAP1 using ab235827 at 1/100 dilution in immunohistochemical analysis.

References

ab235827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up