Overview

  • Product name

    Anti-ACAP2 antibody - C-terminal
    See all ACAP2 primary antibodies
  • Description

    Rabbit polyclonal to ACAP2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human ACAP2 aa 728-778 (C terminal). The exact sequence is proprietary. (NP_036419.3).
    Sequence:

    LARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQK F


    Database link: Q15057

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1, and NIH3T3 whole cell lysates.
  • General notes

     This product was previously labelled as Centaurin beta 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab200583 was affinity purified using an epitope specific to ACAP2 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 88 kDa.

Target

Images

  • All lanes : Anti-ACAP2 antibody - C-terminal (ab200583) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 88 kDa


    Exposure time: 3 minutes
  • Detection of ACAP2 in immunoprecipitates of 293T whole cell lysate (prepared using NETN lysis buffer; 1 mg for IP, 20% of IP loaded) using ab200583 at 6 µg/mg lysate for IP and at 1 µg/ml for subsequent Western blot detection (Lane 1). Lane 2 represents control IgG IP.
    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab200583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up