Anti-ACAT2/Acetyl-CoA acetyltransferase antibody (ab187712)
Key features and details
- Rabbit polyclonal to ACAT2/Acetyl-CoA acetyltransferase
- Suitable for: WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ACAT2/Acetyl-CoA acetyltransferase antibody
See all ACAT2/Acetyl-CoA acetyltransferase primary antibodies -
Description
Rabbit polyclonal to ACAT2/Acetyl-CoA acetyltransferase -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human ACAT2/Acetyl-CoA acetyltransferase aa 150-200 (internal sequence). The exact sequence is proprietary.
Sequence:GLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFD K
Database link: Q9BWD1 -
Positive control
- HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH 3T3 whole cell lysates.
-
General notes
This product was previously labelled as ACAT2, Acetyl-CoA acetyltransferase
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Cholesterol Metabolism
- Metabolism
- Pathways and Processes
- Metabolic signaling pathways
- Lipid and lipoprotein metabolism
- Lipoprotein metabolism
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab187712 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 41 kDa. |
Target
-
Sequence similarities
Belongs to the thiolase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 101143116 Gorilla
- Entrez Gene: 39 Human
- Entrez Gene: 110460 Mouse
- Entrez Gene: 100172365 Orangutan
- Entrez Gene: 708750 Rhesus monkey
- Omim: 100678 Human
- SwissProt: Q9BWD1 Human
- SwissProt: Q8CAY6 Mouse
see all -
Alternative names
- Acat2 antibody
- acetoacetyl CoA thiolase antibody
- acetoacetyl Coenzyme A thiolase antibody
see all
Images
-
All lanes : Anti-ACAT2/Acetyl-CoA acetyltransferase antibody (ab187712) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lane 4 : Mouse TCMK-1 whole cell lysate
Lane 5 : Mouse NIH 3T3 whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 41 kDa
Exposure time: 3 minutes
Datasheets and documents
References (0)
ab187712 has not yet been referenced specifically in any publications.