For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    acat2acetyl-coa-acetyltransferase-antibody-ab187712.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Lipids / Lipoproteins Lipid Metabolism Cholesterol Metabolism
Share by email

Anti-ACAT2/Acetyl-CoA acetyltransferase antibody (ab187712)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-ACAT2/Acetyl-CoA acetyltransferase antibody (ab187712)

    Key features and details

    • Rabbit polyclonal to ACAT2/Acetyl-CoA acetyltransferase
    • Suitable for: WB
    • Reacts with: Mouse, Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-ACAT2/Acetyl-CoA acetyltransferase antibody
      See all ACAT2/Acetyl-CoA acetyltransferase primary antibodies
    • Description

      Rabbit polyclonal to ACAT2/Acetyl-CoA acetyltransferase
    • Host species

      Rabbit
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Mouse, Human
      Predicted to work with: Rhesus monkey, Gorilla, Orangutan
    • Immunogen

      Synthetic peptide within Human ACAT2/Acetyl-CoA acetyltransferase aa 150-200 (internal sequence). The exact sequence is proprietary.
      Sequence:

      GLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFD K


      Database link: Q9BWD1
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • HeLa, 293T, Jurkat, mouse TCMK-1 and mouse NIH 3T3 whole cell lysates.
    • General notes

       This product was previously labelled as ACAT2, Acetyl-CoA acetyltransferase

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7
      Preservative: 0.09% Sodium azide
      Constituent: 99% Tris phosphate

      pH 7 to 8
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Cardiovascular
      • Lipids / Lipoproteins
      • Lipid Metabolism
      • Cholesterol Metabolism
      • Signal Transduction
      • Metabolism
      • Energy Metabolism
      • Cardiovascular
      • Atherosclerosis
      • Lipoprotein metabolism
      • Metabolism
      • Pathways and Processes
      • Metabolic signaling pathways
      • Lipid and lipoprotein metabolism
      • Cholesterol Metabolism
      • Metabolism
      • Pathways and Processes
      • Metabolic signaling pathways
      • Lipid and lipoprotein metabolism
      • Lipoprotein metabolism
      • Metabolism
      • Pathways and Processes
      • Metabolic signaling pathways
      • Energy transfer pathways
      • Energy Metabolism
      • Metabolism
      • Types of disease
      • Heart disease

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Positive Controls

      • HeLa whole cell lysate (ab150035)
      • HeLa whole cell lysate (ab29545)
      • Jurkat whole cell lysate (ab30128)
      • NIH 3T3 whole cell lysate (ab7179)
      • Jurkat whole cell lysate (ab7899)
    • Recombinant Protein

      • Recombinant Human ACAT2/Acetyl-CoA acetyltransferase protein (ab98082)
    • Related Products

      • Recombinant Human ACAT2/Acetyl-CoA acetyltransferase protein (ab185836)

    Applications

    Our Abpromise guarantee covers the use of ab187712 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/2000 - 1/10000. Predicted molecular weight: 41 kDa.

    Target

    • Sequence similarities

      Belongs to the thiolase family.
    • Cellular localization

      Cytoplasm.
    • Target information above from: UniProt accession Q9BWD1 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 101143116 Gorilla
      • Entrez Gene: 39 Human
      • Entrez Gene: 110460 Mouse
      • Entrez Gene: 100172365 Orangutan
      • Entrez Gene: 708750 Rhesus monkey
      • Omim: 100678 Human
      • SwissProt: Q9BWD1 Human
      • SwissProt: Q8CAY6 Mouse
      • Unigene: 571037 Human
      • Unigene: 439711 Mouse
      see all
    • Alternative names

      • Acat2 antibody
      • acetoacetyl CoA thiolase antibody
      • acetoacetyl Coenzyme A thiolase antibody
      • Acetyl CoA acetyltransferase antibody
      • Acetyl CoA transferase like protein antibody
      • acetyl Coenzyme A acetyltransferase 2 antibody
      • Acetyl-CoA acetyltransferase antibody
      • Acetyl-CoA transferase-like protein antibody
      • Acyl Coenzyme A cholesterol acyltransferase 2 antibody
      • Cytosolic acetoacetyl-CoA thiolase antibody
      • cytosolic antibody
      • SOAT2 antibody
      • THIC_HUMAN antibody
      see all

    Images

    • Western blot - Anti-ACAT2/Acetyl-CoA acetyltransferase antibody (ab187712)
      Western blot - Anti-ACAT2/Acetyl-CoA acetyltransferase antibody (ab187712)
      All lanes : Anti-ACAT2/Acetyl-CoA acetyltransferase antibody (ab187712) at 0.1 µg/ml

      Lane 1 : HeLa whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : Jurkat whole cell lysate
      Lane 4 : Mouse TCMK-1 whole cell lysate
      Lane 5 : Mouse NIH 3T3 whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 41 kDa


      Exposure time: 3 minutes

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab187712? Please let us know so that we can cite the reference in this datasheet.

    ab187712 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review

    Filter by Application

    Filter by Species

    Filter by Ratings

    Western blot abreview for Anti-ACAT2/Acetyl-CoA acetyltransferase antibody

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Mouse Tissue lysate - whole (Duodenum)
    Gel Running Conditions
    Reduced Denaturing (12.5%)
    Loading amount
    30 µg
    Specification
    Duodenum
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
    Read More

    Abcam user community

    Verified customer

    Submitted May 04 2017

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.