Overview

  • Product name

  • Description

    Rabbit polyclonal to ACBD3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ACBD3 aa 263-366.
    Sequence:

    AQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVV AGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGP KESL


    Database link: Q9H3P7

  • Positive control

    • IHC-P: Human appendix and prostate tissues. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237543 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi. Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.
  • Tissue specificity

    Ubiquitous, with highest expression in testis and ovary.
  • Sequence similarities

    Contains 1 ACB (acyl-CoA-binding) domain.
    Contains 1 GOLD domain.
  • Domain

    The GOLD domain is essential for giantin binding.
  • Cellular localization

    Golgi apparatus membrane. Mitochondrion. Also mitochondrial (via its interaction with PBR).
  • Information by UniProt
  • Database links

  • Alternative names

    • ACBD 3 antibody
    • ACBD3 antibody
    • Acyl CoA binding domain containing protein 3 antibody
    • Acyl Coenzyme A binding domain containing 3 antibody
    • Acyl-CoA-binding domain-containing protein 3 antibody
    • GCP 60 antibody
    • GCP60 antibody
    • GCP60_HUMAN antibody
    • GOCAP 1 antibody
    • GOCAP1 antibody
    • Golgi complex associated protein 1 60kDa antibody
    • Golgi complex associated protein 1 antibody
    • Golgi complex-associated protein 1 antibody
    • Golgi phosphoprotein 1 antibody
    • Golgi resident protein GCP60 antibody
    • GOLPH 1 antibody
    • GOLPH1 antibody
    • PAP 7 antibody
    • PAP7 antibody
    • PBR and PKA associated protein 7 antibody
    • PBR associated protein antibody
    • PBR- and PKA-associated protein 7 antibody
    • Peripheral benzodiazepine receptor associated protein PAP7 antibody
    • Peripheral benzodiazepine receptor-associated protein PAP7 antibody
    • Peripherial benzodiazepine receptor associated protein antibody
    • PKA (RIalpha) associated protein antibody
    see all

Images

  • Paraffin-embedded human appendix tissue stained for ACBD3 using ab237543 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human prostate tissue stained for ACBD3 using ab237543 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for ACBD3 (green) using ab237543 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

References

ab237543 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237543.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up