Overview

  • Product name

  • Description

    Rabbit polyclonal to ACD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Horse, Guinea pig, Dog
  • Immunogen

    Synthetic peptide corresponding to Mouse ACD aa 351-400 (C terminal).
    Sequence:

    PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA


    Database link: NP_001012656

  • Positive control

    • Mouse muscle tissue lysate.
  • General notes

     This product was previously labelled as PTOP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab104297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa. Mouse protein 45kD Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Promotes binding of POT1 to single-stranded telomeric DNA. Modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity. Plays a role in shelterin complex assembly. May play a role in organogenesis.
  • Cellular localization

    Nucleus. Chromosome > telomere.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acd antibody
    • ACD_HUMAN antibody
    • Adrenocortical dysplasia homolog antibody
    • Adrenocortical dysplasia protein homolog antibody
    • PIP1 antibody
    • POT1 and TIN2 organizing protein antibody
    • POT1 and TIN2-interacting protein antibody
    • TIN2 interacting protein 1 antibody
    • TINT1 antibody
    • TPP1 antibody
    see all

Images

  • Anti-ACD antibody (ab104297) at 1 µg/ml + Mouse muscle tissue lysate at 10 µg

    Predicted band size: 58 kDa



    12% SDS-PAGE. Mouse protein predicted molecular weight 45kD.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up