Overview

  • Product name

  • Description

    Rabbit polyclonal to ACD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ACD aa 280-360.
    Sequence:

    TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPC QRTQGPELPPPDPALQDLSLTLIASPPSSPS


    Database link: Q96AP0

  • Positive control

    • U-2 OS cells.
  • General notes

     This product was previously labelled as PTOP

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Promotes binding of POT1 to single-stranded telomeric DNA. Modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity. Plays a role in shelterin complex assembly. May play a role in organogenesis.
  • Cellular localization

    Nucleus. Chromosome > telomere.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acd antibody
    • ACD_HUMAN antibody
    • Adrenocortical dysplasia homolog antibody
    • Adrenocortical dysplasia protein homolog antibody
    • PIP1 antibody
    • POT1 and TIN2 organizing protein antibody
    • POT1 and TIN2-interacting protein antibody
    • TIN2 interacting protein 1 antibody
    • TINT1 antibody
    • TPP1 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized U-2 OS cells labeling ACD with ab220740 at 4 μg/ml (green).

References

ab220740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up