Overview

  • Product name

  • Description

    Rabbit polyclonal to ACD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse ACD aa 21-175. (Expressed in E.coli).
    Sequence:

    ETLSSPRTGQLLKVLQDSETPGPSSAPDTPDTGAVLLVSDGTHSVRCVVT RNAIDTSDWEEKELGFRGTEGRLLLLQACGLRVQVAQDHAPAEFYLQVDR FNLLPTEQPRIQVTGCNQDSDVQRKLNECLEDHLSESASSSAGLTLSQLL DEVRE


    Database link: Q5EE38

  • Positive control

    • WB: Recombinant mouse ACD protein; Jurkat and HeLa cell lysates; Mouse testis lysate. IHC-P: Mouse kidney and colon tissues.
  • General notes

     This product was previously labelled as PTOP

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231330 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Function

    Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Promotes binding of POT1 to single-stranded telomeric DNA. Modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity. Plays a role in shelterin complex assembly. May play a role in organogenesis.
  • Cellular localization

    Nucleus. Chromosome > telomere.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acd antibody
    • ACD_HUMAN antibody
    • Adrenocortical dysplasia homolog antibody
    • Adrenocortical dysplasia protein homolog antibody
    • PIP1 antibody
    • POT1 and TIN2 organizing protein antibody
    • POT1 and TIN2-interacting protein antibody
    • TIN2 interacting protein 1 antibody
    • TINT1 antibody
    • TPP1 antibody
    see all

Images

  • Anti-ACD antibody (ab231330) at 2 µg/ml + Recombinant mouse ACD

    Predicted band size: 45 kDa

  • Anti-ACD antibody (ab231330) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 45 kDa

  • Anti-ACD antibody (ab231330) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 45 kDa

  • Anti-ACD antibody (ab231330) at 2 µg/ml + Mouse testis lysate

    Predicted band size: 45 kDa

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for ACD using ab231330 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse colon tissue stained for ACD using ab231330 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab231330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up