Overview

  • Product name

  • Description

    Rabbit polyclonal to ACG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ACG aa 283-376.
    Sequence:

    KDTVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGD GRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTF


    Database link: Q5JSL3

  • Positive control

    • Human testis, urinary bladder and melanoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab190270 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Guanine nucleotide-exchange factor (GEF) that activates CDC42 by exchanging bound GDP for free GTP.
  • Sequence similarities

    Belongs to the DOCK family.
    Contains 1 DHR-1 (CZH-1) domain.
    Contains 1 DHR-2 (CZH-2) domain.
    Contains 1 PH domain.
  • Domain

    The DHR-2 domain is necessary for the GEF activity.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACG antibody
    • Activated Cdc42-associated guanine nucleotide exchange factor antibody
    • Dedicator of cytokinesis protein 11 antibody
    • DOC11_HUMAN antibody
    • Dock11 antibody
    • ZIZ2 antibody
    • Zizimin-2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling ACG with ab190270 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human urinary bladder tissue labeling ACG with ab190270 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human melanoma tissue labeling ACG with ab190270 at 1/200 dilution.

References

ab190270 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190270.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up