Overview

  • Product name

  • Description

    Rabbit polyclonal to ACK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ACK1 aa 1-1038.
    Sequence:

    MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIG MGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRK TSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSG KTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPP MKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIH RDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERL PRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFE EPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLS AQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNPMDPPDLLSVE LSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAK PSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLL DETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSI NSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSS AQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPT RPHVQLSPAPPGEEETSQWPGPASPPRVPPREPLSPQGSRTPSPLVPPGS SPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRD GKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTP APAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPG DGPEAGRPADKIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFG LGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR


    Database link: Q07912

  • Positive control

    • SW620, HT-29, MCF7 and Raji cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab185726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 115 kDa.
IHC-P 1/50 - 1/200.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Non-receptor tyrosine kinase that regulates the activity of a number of proteins by tyrosine phosphorylation especially proteins critical for cell survival, cell growth, and proliferation. Activates AKT1 by phosphorylating it on 'Tyr-176' resulting in its activation. Phosphorylates AR on 'Tyr-267' and 'Tyr-363' and promotes its recruitment to the androgen-responsive enhancers (AREs). Phosphorylates WWOX on 'Tyr-287'. Downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. Binds to both poly- and mono-ubiquitin and regulates ligand-induced degradation of EGFR. Participates in clathrin-mediated endocytosis. May be involved both in adult synaptic function and plasticity and in brain development.
  • Tissue specificity

    The Tyr-284 phosphorylated form shows a significant increase in expression in breast cancers during the progressive stages i.e. normal to hyperplasia (ADH), ductal carcinoma in situ (DCIS), invasive ductal carcinoma (IDC) and lymph node metastatic (LNMM) stages. It also shows a significant increase in expression in prostate cancers during the progressive stages.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 CRIB domain.
    Contains 1 protein kinase domain.
    Contains 1 SH3 domain.
    Contains 1 UBA domain.
  • Domain

    The EBD (EGFR-binding domain) domain is necessary for interaction with EGFR.
    The SAM-like domain is necessary for NEDD4-mediated ubiquitination. Promotes membrane localization and dimerization to allow for autophosphorylation.
    The UBA domain binds both poly- and mono-ubiquitin.
  • Post-translational
    modifications

    Autophosphorylation regulates kinase activity. Phosphorylation on Tyr-518 is required for interaction with SRC.
    Ubiquitinated by NEDD4. Its EGF-induced degradation is EGFR activation-dependent and is processed by lysosomes, not proteasomes.
  • Cellular localization

    Cell membrane. Nucleus. Endosome. Cell junction > adherens junction. Cytoplasmic vesicle membrane. The Tyr-284 phosphorylated form is expressed both in the membrane and nucleus. Co-localizes with EGFR on the endosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acetate kinase 1 antibody
    • Acetokinase 1 antibody
    • ACK 1 antibody
    • ACK antibody
    • ACK-1 antibody
    • ACK1 antibody
    • ACK1_HUMAN antibody
    • Activated Cdc42 associated kinase 1 antibody
    • Activated CDC42 kinase 1 antibody
    • Activated p21cdc42Hs kinase antibody
    • FLJ44758 antibody
    • FLJ45547 antibody
    • p21cdc42Hs antibody
    • TNK 2 antibody
    • TNK2 antibody
    • Tyrosine kinase non receptor 2 antibody
    • Tyrosine kinase non receptor protein 2 antibody
    • Tyrosine kinase non-receptor protein 2 antibody
    see all

Images

  • All lanes : Anti-ACK1 antibody (ab185726) at 1/500 dilution

    Lane 1 : SW620 cell lysate
    Lane 2 : HT29 cell lysate
    Lane 3 : MCF7 cell lysate
    Lane 4 : Raji cell lysate

    Predicted band size: 115 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat spleen tissue labelling ACK1 with ab185726 at 1/200. Magnification: 400x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human rectal cancer tissue labelling ACK1 with ab185726 at 1/200. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney cancer tissue labelling ACK1 with ab185726 at 1/200. Magnification: 400x.
  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185726. Blue DAPI for nuclear staining.

References

ab185726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up