Overview

  • Product name

    Anti-Aconitase 1/ACO1 antibody
    See all Aconitase 1/ACO1 primary antibodies
  • Description

    Rabbit polyclonal to Aconitase 1/ACO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Aconitase 1/ACO1 aa 26-243. (Expressed in E.coli)
    Sequence:

    KLEDSRYGRLPFSIRVLLEAAIRNCDEFLVKKQDIENILHWNVTQHKNIE VPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPVCPADLVID HSIQVDFNRRADSLQKNQDLEFERNRERFEFLKWGSQAFHNMRIIPPGSG IIHQVNLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGILGWGVGGIE AEAVMLGQPISMVLPQVI


    Database link: P21399

  • Positive control

    • WB: Recombinant human Aconitase 1/ACO1 protein; HeLa and HepG2 cell lysates.
  • General notes

     This product was previously labelled as Aconitase 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 98 kDa.

Target

  • Function

    Iron sensor. Binds a 4Fe-4S cluster and functions as aconitase when cellular iron levels are high. Functions as mRNA binding protein that regulates uptake, sequestration and utilization of iron when cellular iron levels are low. Binds to iron-responsive elements (IRES) in target mRNA species when iron levels are low. Binding of a 4Fe-4S cluster precludes RNA binding.
    Catalyzes the isomerization of citrate to isocitrate via cis-aconitate.
  • Sequence similarities

    Belongs to the aconitase/IPM isomerase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACO 1 antibody
    • ACO1 antibody
    • ACOC_HUMAN antibody
    • Aconitase 1 soluble antibody
    • Aconitase antibody
    • Aconitase1 antibody
    • Aconitate hydratase antibody
    • ACONS antibody
    • Citrate hydro lyase antibody
    • Citrate hydro-lyase antibody
    • Cytoplasmic aconitate hydratase antibody
    • Ferritin repressor protein antibody
    • IRE BP 1 antibody
    • IRE-BP 1 antibody
    • IREB 1 antibody
    • IREB1 antibody
    • IREBP antibody
    • IREBP1 antibody
    • Iron regulatory protein 1 antibody
    • Iron responsive element binding protein 1 antibody
    • Iron-responsive element-binding protein 1 antibody
    • IRP 1 antibody
    • IRP1 antibody
    • OTTHUMP00000045233 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human lung tissue staining Aconitase 1/ACO1 using ab231353 10 µg/mL

     

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human kidney tissue staining Aconitase 1/ACO1 using ab231353 10 µg/mL

     

  • Anti-Aconitase 1/ACO1 antibody (ab231353) at 3 µg/ml + Recombinant human Aconitase 1/ACO1 protein.

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 98 kDa

  • All lanes : Anti-Aconitase 1/ACO1 antibody (ab231353) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 98 kDa

References

ab231353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up