Overview

  • Product name

  • Description

    Rabbit polyclonal to ACRV1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ACRV1 aa 22-265. Full-length mature chain without the signal peptide.
    Sequence:

    QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSS EHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSG EHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASG EQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKK IFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI


    Database link: P26436-1

  • Positive control

    • IHC-P: Human testis tissue.
  • General notes

     This product was previously labelled as Intra Acrosomal Protein

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Testis.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > acrosome. Nascent acrosomal vesicle of Golgi phase spermatids.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acrosomal protein SP 10 antibody
    • Acrosomal protein SP-10 antibody
    • Acrosomal vesicle protein 1 antibody
    • ACRV1 antibody
    • ASPX_HUMAN antibody
    • D11S4365 antibody
    • Msa63 antibody
    • SP 10 antibody
    • Sp10 antibody
    • SPACA2 antibody
    • Sperm protein 10 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for ACRV1 using ab238863 at 1/100 dilution in immunohistochemical analysis.

References

ab238863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up