Overview

  • Product name

  • Description

    Rabbit polyclonal to ACSL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 470-519

    ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG

    of Human ACSL5 (NP_976313).

  • Positive control

    • Human placenta lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab104892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 4 - 8 µg/ml.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 76 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    ACSL5 is an isozyme of the long chain fatty acid coenzyme A ligase family. All isozymes of this family convert free long chain fatty acids into fatty acyl CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. ACSL5 is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid induced glioma cell growth. Three transcript variants encoding two different isoforms have been found.
  • Cellular localization

    Mitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane. Endoplasmic reticulum membrane.
  • Database links

  • Alternative names

    • ACS2 antibody
    • ACS5 antibody
    • Acyl CoA synthetase 5 antibody
    • Acyl CoA synthetase long chain family member 5 antibody
    • EC 6.2.1.3 antibody
    • FACL5 antibody
    • FACL5 for fatty acid coenzyme A ligase 5 antibody
    • Fatty acid CoA ligase, long chain 5 antibody
    • Fatty acid coenzyme A ligase 5 antibody
    • Fatty acid Coenzyme A ligase long chain 5 antibody
    • LACS 5 antibody
    • Long chain acyl CoA synthetase 5 antibody
    • Long chain fatty acid CoA ligase 5 antibody
    • Long chain fatty acid coenzyme A ligase 5 antibody
    see all

Images

  • Anti-ACSL5 antibody (ab104892) at 1 µg/ml + Human placenta lysate at 10 µg


    Gel concentration 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skeletal muscle tissue labelling ACSL5 with ab104892 at 4-8µg/ml.

References

This product has been referenced in:

  • Heischmann S  et al. The Immunosuppressant Mycophenolic Acid Alters Nucleotide and Lipid Metabolism in an Intestinal Cell Model. Sci Rep 7:45088 (2017). Read more (PubMed: 28327659) »
  • Ansari IH  et al. Characterization of Acyl-CoA synthetase isoforms in pancreatic beta cells: Gene silencing shows participation of ACSL3 and ACSL4 in insulin secretion. Arch Biochem Biophys 618:32-43 (2017). Read more (PubMed: 28193492) »
See all 3 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Abreviews
Application
Western blot
Sample
Zebrafish Tissue lysate - whole (Brain)
Gel Running Conditions
Reduced Denaturing (gel Bolt 4-12% Bis-Tris-Plus (Invitrogen, ThermoFisher Scientific)
Loading amount
20 µg
Specification
Brain
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 23°C

Barrakatou Ligali Epse Cisse

Verified customer

Submitted Feb 19 2019

Abreviews
Application
Western blot
Sample
Mouse Cell lysate - whole cell (C2C12)
Gel Running Conditions
Reduced Denaturing (gel Bolt 4-12% Bis-Tris-Plus (Invitrogen, ThermoFisher Scientific)
Loading amount
20 µg
Specification
C2C12
Blocking step
Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 23°C

Barrakatou Ligali Epse Cisse

Verified customer

Submitted Feb 18 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up