Overview

  • Product name

    Anti-ACSM5 antibody
  • Description

    Rabbit polyclonal to ACSM5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ACSM5 aa 1-53.
    Sequence:

    MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVP EYF


    Database link: Q6NUN0

  • Positive control

    • IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab243447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro).
  • Tissue specificity

    Detected in kidney and liver.
  • Sequence similarities

    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acsm5 antibody
    • ACSM5_HUMAN antibody
    • Acyl CoA synthetase medium chain family member 5 antibody
    • Acyl coenzyme A synthetase ACSM5, mitochondrial antibody
    • Acyl-coenzyme A synthetase ACSM5 antibody
    • FLJ20581 antibody
    • MACS3 antibody
    • mitochondrial antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for ACSM5 with ab243447 at a 1/20 dilution in immunohistochemical analysis.

References

ab243447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up