Overview

  • Product name

    Anti-ACSS1 antibody
  • Description

    Rabbit polyclonal to ACSS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ACSS1 aa 53-150.
    Sequence:

    AQPGSYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGW FLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVRITYRELLETT


    Database link: Q9NUB1

  • Positive control

    • WB: MOLT-4 cell lysare. IHC-P: Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab224176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500. Predicted molecular weight: 74 kDa.

Target

  • Function

    Important for maintaining normal body temperature during fasting and for energy homeostasis. Essential for energy expenditure under ketogenic conditions (By similarity). Converts acetate to acetyl-CoA so that it can be used for oxidation through the tricarboxylic cycle to produce ATP and CO(2).
  • Sequence similarities

    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Post-translational
    modifications

    Reversibly acetylated on Lys-642. The acetyl-CoA synthase activity is inhibited by acetylation and activated by deacetylation.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACAS2L antibody
    • AceCS2 antibody
    • AceCS2L antibody
    • Acetate CoA ligase 2 antibody
    • Acetate--CoA ligase 2 antibody
    • Acetyl CoA synthetase 2 antibody
    • Acetyl Coenzyme A synthetase 2 (AMP forming) like antibody
    • Acetyl coenzyme A synthetase 2 like, mitochondrial antibody
    • Acetyl-CoA synthetase 2 antibody
    • Acetyl-coenzyme A synthetase 2-like, mitochondrial antibody
    • ACS2L_HUMAN antibody
    • Acss1 antibody
    • Acyl CoA synthetase short chain family member 1 antibody
    • Acyl-CoA synthetase short-chain family member 1 antibody
    • FLJ45659 antibody
    • KIAA1846 antibody
    • MGC33843 antibody
    see all

Images

  • Anti-ACSS1 antibody (ab224176) at 1/250 dilution + MOLT-4 (human lymphoblastic leukemia cell line) cell lysate

    Predicted band size: 74 kDa

  • Paraffin-embedded human kidney tissue stained for ACSS1 with ab224176 (1/50) in immunohistochemical analysis.

References

ab224176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up