Overview

  • Product name

  • Description

    Rabbit polyclonal to ACSS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Recombinant full length protein corresponding to Mouse ACSS2 aa 1-701.
    Sequence:

    MGLPEERRKSGSGSRAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYREL HRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGAT TNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSN VLRKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLC ERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVV KHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAGDEC EPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPE DVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDK YKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWY HRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAI LNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTYFKKFPGYYVT GDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVV GHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQN APGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFSHRCLTT Q


    Database link: Q9QXG4

  • Positive control

    • WB: Rat and mouse heart tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab234689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 79, 50 kDa (predicted molecular weight: 79 kDa).

Target

  • Function

    Activates acetate so that it can be used for lipid synthesis or for energy generation.
  • Sequence similarities

    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACAS2 antibody
    • AceCS antibody
    • Acetate CoA ligase antibody
    • Acetate thiokinase antibody
    • Acetate--CoA ligase antibody
    • Acetyl CoA synthetase antibody
    • Acetyl Coenzyme A synthetase 2 (ADP forming) antibody
    • Acetyl coenzyme A synthetase cytoplasmic antibody
    • Acetyl-CoA synthetase antibody
    • Acetyl-coenzyme A synthetase antibody
    • ACS antibody
    • ACSA antibody
    • ACSA_HUMAN antibody
    • ACSS2 antibody
    • Acyl activating enzyme antibody
    • Acyl CoA synthetase short chain family member 2 antibody
    • Acyl-activating enzyme antibody
    • Acyl-CoA synthetase short-chain family member 2 antibody
    • Cytoplasmic acetyl coenzyme A synthetase antibody
    • cytoplasmic antibody
    • MYH7B antibody
    see all

Images

  • All lanes : Anti-ACSS2 antibody (ab234689) at 1/500 dilution

    Lane 1 : Rat heart tissue lysate
    Lane 2 : Mouse heart tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 79 kDa
    Observed band size: 50,79 kDa
    why is the actual band size different from the predicted?

References

ab234689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up