Overview

  • Product name

  • Description

    Rabbit polyclonal to ACSS3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ACSS3 aa 61-152.
    Sequence:

    EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGML NICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQ


    Database link: Q9H6R3

  • Positive control

    • IHC-P: Human liver tissue; WB: RT4 and liver cell lysate.
  • General notes

     This product was previously labelled as ACSS3, FLJ21963

     

Properties

Applications

Our Abpromise guarantee covers the use of ab188009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 75 kDa.

Target

Images

  • All lanes : Anti-ACSS3 antibody (ab188009) at 0.4 µg/ml

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Plasma cell lysate
    Lane 4 : Liver cell lysate
    Lane 5 : Tonsil cell lysate

    Predicted band size: 75 kDa

  • Immunohistochemical analysis of paraffin-embedded Human liver tissue labeling ACSS3 with ab188009 at 1/50 dilution.

  • Anti-ACSS3 antibody (ab188009) at 1/100 dilution + RT4 cell lysate

    Predicted band size: 75 kDa

References

ab188009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up