Overview

  • Product name

  • Description

    Rabbit polyclonal to ACTC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human ACTC1 aa 44-269.
    Sequence:

    GVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFY NELRVAPEEH PTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGI VLDSGDGVTH NVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRD IKEKLCYVAL DFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFI


    Database link: BC009978

  • Positive control

    • 293T cell lysate; Human fetal heart tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab199258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 42 kDa.

Target

  • Function

    Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
  • Involvement in disease

    Defects in ACTC1 are the cause of cardiomyopathy dilated type 1R (CMD1R) [MIM:613424]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in ACTC1 are the cause of cardiomyopathy familial hypertrophic type 11 (CMH11) [MIM:612098]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in ACTC1 are the cause of atrial septal defect type 5 (ASD5) [MIM:612794]. A congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria.
  • Sequence similarities

    Belongs to the actin family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACTC antibody
    • ACTC_HUMAN antibody
    • ACTC1 antibody
    • Actin alpha cardiac muscle 1 antibody
    • Actin antibody
    • alpha cardiac muscle 1 antibody
    • Alpha-cardiac actin antibody
    • ASD5 antibody
    • CMD1R antibody
    • CMH11 antibody
    • LVNC4 antibody
    see all

Images

  • Anti-ACTC1 antibody (ab199258) at 1/1000 dilution + 293T cell lysate

    Predicted band size: 42 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal heart tissue labeling muscle Actin with ab199258 at 1/100 dilution.

References

ab199258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up