Overview

  • Product name

    Anti-ACTC1 antibody [C3]
    See all ACTC1 primary antibodies
  • Description

    Mouse monoclonal [C3] to ACTC1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Chicken, Cow, Human, Xenopus tropicalis
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human ACTC1 aa 156-368. N-terminal tags. Expressed in E.coli.
    Sequence:

    DSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTT AEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNE RFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGT TMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ QMWISKQEYDEAG


    Database link: P68032

  • Positive control

    • WB: Recombinant human ACTC1 protein; Mouse heart, skeletal muscle and skin lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab239475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function

    Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
  • Involvement in disease

    Defects in ACTC1 are the cause of cardiomyopathy dilated type 1R (CMD1R) [MIM:613424]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in ACTC1 are the cause of cardiomyopathy familial hypertrophic type 11 (CMH11) [MIM:612098]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in ACTC1 are the cause of atrial septal defect type 5 (ASD5) [MIM:612794]. A congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria.
  • Sequence similarities

    Belongs to the actin family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACTC antibody
    • ACTC_HUMAN antibody
    • ACTC1 antibody
    • Actin alpha cardiac muscle 1 antibody
    • Actin antibody
    • alpha cardiac muscle 1 antibody
    • Alpha-cardiac actin antibody
    • ASD5 antibody
    • CMD1R antibody
    • CMH11 antibody
    • LVNC4 antibody
    see all

Images

  • Anti-ACTC1 antibody [C3] (ab239475) at 3 µg/ml + Recombinant human ACTC1 protein

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 42 kDa

  • All lanes : Anti-ACTC1 antibody [C3] (ab239475) at 3 µg/ml

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse skeletal muscle lysate
    Lane 3 : Mouse skin lysate

    Secondary
    All lanes : HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 42 kDa

References

ab239475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up