ACTH (1-39) (rat), melanocortin 2 (MC2) receptor agonist (ab142252)

Overview

  • Product name

    ACTH (1-39) (rat), melanocortin 2 (MC2) receptor agonist
  • Description

    Potent melanocortin 2 (MC2) receptor agonist
  • Alternative names

    • Adrenocorticotropic hormone
    • Adrenocorticotropin
    • corticotropin
  • Biological description

    Potent ACTH and melanocortin 2 (MC2) receptor agonist (EC50 = 1 nM). Full length endogenous anterior pituitary hormone. Stimulates the release of corticosteroids from the adrenal cortex. Multiple biological activities. Active in vivo.
  • Purity

    > 95%
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4582.30
  • Molecular formula

    C207H308N56O58S
  • Sequence

    SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
  • PubChem identifier

    16132265
  • Storage instructions

    Store at +4°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • SMILES

    CC(C)CC(C(=O)NC(CCC(=O)O)C(=O)NC(CC1=CC=CC=C1)C(=O)O)NC(=O)C2CCCN2C(=O)C(CC3=CC=CC=C3)NC(=O)C(C)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(CO)NC(=O)C(CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)CNC(=O)C(CC(=O)N)NC(=O)C4CCCN4C(=O)C(CC5=CC=C(C=C5)O)NC(=O)C(C(C)C)NC(=O)C(CCCCN)NC(=O)C(C(C)C)NC(=O)C6CCCN6C(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCCN)NC(=O)C(CCCCN)NC(=O)CNC(=O)C(C(C)C)NC(=O)C7CCCN7C(=O)C(CCCCN)NC(=O)CNC(=O)C(CC8=CNC9=CC=CC=C98)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC1=CC=CC=C1)NC(=O)
  • Source

    Synthetic

  • Research areas

References

This product has been referenced in:

  • Papadimitriou A & Priftis KN Regulation of the hypothalamic-pituitary-adrenal axis. Neuroimmunomodulation 16:265-71 (2009). Read more (PubMed: 19571587) »
  • Boston BA & Cone RD Characterization of melanocortin receptor subtype expression in murine adipose tissues and in the 3T3-L1 cell line. Endocrinology 137:2043-50 (1996). Read more (PubMed: 8612546) »
  • Cammas FM  et al. Cloning, characterization and expression of a functional mouse ACTH receptor. Biochem Biophys Res Commun 212:912-8 (1995). Read more (PubMed: 7626130) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab142252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up