Anti-ACTH antibody (ab74976)
Key features and details
- Rabbit polyclonal to ACTH
- Suitable for: IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-ACTH antibody
See all ACTH primary antibodies -
Description
Rabbit polyclonal to ACTH -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Sheep, Goat, Chicken, Guinea pig, Cow, Dog, Chimpanzee, Macaque monkey, Orangutan -
Immunogen
Synthetic peptide corresponding to ACTH aa 1-39. This corresponds to amino acids 138-176 of the precursor POMC.
Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Database link: P01189 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
Preservative: 0.02% Sodium azide -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab74976 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | (2) |
Use at an assay dependent concentration.
|
Notes |
---|
IHC-P
Use at an assay dependent concentration. |
Target
-
Relevance
ACTH occurs in cells of the anterior pituitary and in neurons in brain. It regulates the corticosteroid production in the adrenal cortex. Beta endorphin and Met enkephalin are endogenous opiates. MSH (melanocyte stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 5443 Human
- Entrez Gene: 694430 Macaque monkey
- Entrez Gene: 18976 Mouse
- Entrez Gene: 24664 Rat
- Entrez Gene: 443212 Sheep
- Omim: 176830 Human
- SwissProt: P01190 Cow
- SwissProt: P19402 Guinea pig
see all -
Alternative names
- ACTH antibody
- Adrenocorticotropic hormone antibody
- Adrenocorticotropin antibody
see all
Images
-
Formalin-fixed, paraffin-embedded mouse brain tissue stained for ACTH with ab74976 (1/100 dilution) in immunohistochemical analysis. DAB (brown) and Hematoxylin (blue)staining.
-
ab74976 staining ACTH in P0 Pitx2-Cre/Dicer1 mutant mice pituitary tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
Samples were fixed in 4% paraformaldehyde, dehydrated, and embedded in paraffin wax. Sections were cut (7 µm) and stained with H&E. Immunohistochemistry was performed on 7-µm paraffin sections stained by an indirect immunoperoxidase method. Peroxidase activity was visualized with AEC stain kit. ab74976 diluted 1/200. Secondary antibodies conjugated with biotin were used at 1/150 dilution.
Datasheets and documents
-
SDS download
-
Datasheet download
References (23)
ab74976 has been referenced in 23 publications.
- Liu M et al. Evidence for Neuropeptide W Acting as a Physiological Corticotropin-releasing Inhibitory Factor in Male Chickens. Endocrinology 163:N/A (2022). PubMed: 35583189
- Wan Y et al. Characterization of CRH-Binding Protein (CRHBP) in Chickens: Molecular Cloning, Tissue Distribution and Investigation of Its Role as a Negative Feedback Regulator within the Hypothalamus-Pituitary-Adrenal Axis. Genes (Basel) 13:N/A (2022). PubMed: 36292565
- Royan MR et al. 3D Atlas of the Pituitary Gland of the Model Fish Medaka (Oryzias latipes). Front Endocrinol (Lausanne) 12:719843 (2021). PubMed: 34497587
- Fujita Y et al. Clinical Heterogeneity of Acquired Idiopathic Isolated Adrenocorticotropic Hormone Deficiency. Front Endocrinol (Lausanne) 12:578802 (2021). PubMed: 33679614
- Kanie K et al. Mechanistic insights into immune checkpoint inhibitor-related hypophysitis: a form of paraneoplastic syndrome. Cancer Immunol Immunother N/A:N/A (2021). PubMed: 33977343