For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    acth-antibody-ab74976.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmitter Neuropeptides Hormones
Share by email

Anti-ACTH antibody (ab74976)

  • Datasheet
  • SDS
Reviews (2)Q&A (2)References (14)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)

Key features and details

  • Rabbit polyclonal to ACTH
  • Suitable for: IHC-P
  • Reacts with: Mouse, Rat, Human
  • Isotype: IgG

You may also be interested in

Primary
Anti-Growth Hormone antibody (ab126882)
Assay
Mammalian Cell Lysis Buffer 5X (ab179835)
Primary
Product image
Anti-Prolactin/PRL antibody [EPR19386] (ab183967)

View more associated products

Overview

  • Product name

    Anti-ACTH antibody
    See all ACTH primary antibodies
  • Description

    Rabbit polyclonal to ACTH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Sheep, Goat, Chicken, Guinea pig, Cow, Dog, Chimpanzee, Macaque monkey, Orangutan
  • Immunogen

    Synthetic peptide corresponding to ACTH aa 1-39. This corresponds to amino acids 138-176 of the precursor POMC.
    Sequence:

    SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF


    Database link: P01189
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.02% Sodium azide
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurotransmitter
    • Neuropeptides
    • Hormones
    • Signal Transduction
    • Growth Factors/Hormones
    • Hormones
    • Neuroscience
    • Endocrine system
    • Hypothalamic pituitary adrenal axis
    • Cancer
    • Tumor biomarkers
    • Hormones
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Hormone biosynthesis
    • Metabolism
    • Pathways and Processes
    • Endocrine metabolism
    • Hormone biosynthesis
    • Metabolism
    • Types of disease
    • Obesity
    • Metabolism
    • Types of disease
    • Cancer

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab74976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P (1)
Use at an assay dependent concentration.
Notes
IHC-P
Use at an assay dependent concentration.

Target

  • Relevance

    ACTH occurs in cells of the anterior pituitary and in neurons in brain. It regulates the corticosteroid production in the adrenal cortex. Beta endorphin and Met enkephalin are endogenous opiates. MSH (melanocyte stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.
  • Cellular localization

    Secreted
  • Database links

    • Entrez Gene: 5443 Human
    • Entrez Gene: 694430 Macaque monkey
    • Entrez Gene: 18976 Mouse
    • Entrez Gene: 24664 Rat
    • Entrez Gene: 443212 Sheep
    • Omim: 176830 Human
    • SwissProt: P01190 Cow
    • SwissProt: P19402 Guinea pig
    • SwissProt: P01189 Human
    • SwissProt: P01201 Macaque monkey
    • SwissProt: P01193 Mouse
    • SwissProt: P01194 Rat
    • SwissProt: P01191 Sheep
    see all
  • Alternative names

    • ACTH antibody
    • Adrenocorticotropic hormone antibody
    • Adrenocorticotropin antibody
    • Alpha melanocyte stimulating hormone antibody
    • alpha-MSH antibody
    • alphaMSH antibody
    • Beta LPH antibody
    • Beta melanocyte stimulating hormone antibody
    • Beta-endorphin antibody
    • beta-MSH antibody
    • CLIP antibody
    • Corticotropin antibody
    • Corticotropin lipotropin antibody
    • Corticotropin-like intermediary peptide antibody
    • Gamma LPH antibody
    • gamma-MSH antibody
    • Lipotropin beta antibody
    • Lipotropin gamma antibody
    • Lipotropin, included antibody
    • LPH antibody
    • Melanocyte-stimulating hormone, included antibody
    • Melanotropin alpha antibody
    • Melanotropin beta antibody
    • Melanotropin gamma antibody
    • Melanotropin, included antibody
    • Met-enkephalin antibody
    • MSH antibody
    • NPP antibody
    • Opiomelanocortin prepropeptide antibody
    • POC antibody
    • POMC antibody
    • Pomc-1 antibody
    • Pomc1 antibody
    • Pomc2 antibody
    • Pro ACTH endorphin antibody
    • Pro opiomelanocortin antibody
    • Pro-opiomelanocortin-alpha antibody
    • Proopiomelanocortin antibody
    • Proopiomelanocortin preproprotein antibody
    • Tetracosactide antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)

    Formalin-fixed, paraffin-embedded mouse brain tissue stained for ACTH with ab74976 (1/100 dilution) in immunohistochemical analysis. DAB (brown) and Hematoxylin (blue)staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ACTH antibody (ab74976)Image from Zhang Z et al, J Biol Chem. 2010 Nov 5;285(45):34718-28. Epub 2010 Aug 31, Fig 4. DOI 10.1074/jbc.M110.126441

    ab74976 staining ACTH in P0 Pitx2-Cre/Dicer1 mutant mice pituitary tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).

    Samples were fixed in 4% paraformaldehyde, dehydrated, and embedded in paraffin wax. Sections were cut (7 µm) and stained with H&E. Immunohistochemistry was performed on 7-µm paraffin sections stained by an indirect immunoperoxidase method. Peroxidase activity was visualized with AEC stain kit. ab74976 diluted 1/200. Secondary antibodies conjugated with biotin were used at 1/150 dilution.

Protocols

  • Immunohistochemistry protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (14)

Publishing research using ab74976? Please let us know so that we can cite the reference in this datasheet.

ab74976 has been referenced in 14 publications.

  • Wong C  et al. Two well-differentiated pancreatic neuroendocrine tumor mouse models. Cell Death Differ 27:269-283 (2020). PubMed: 31160716
  • Hojo M  et al. A histopathological analysis of spontaneous neoplastic and non-neoplastic lesions in aged male RccHan:WIST rats. J Toxicol Pathol 33:47-55 (2020). PubMed: 32051666
  • Liu S  et al. Adrenocorticotropic Hormone-Producing Paraganglioma With Low Plasma ACTH Level: A Case Report and Review of the Literature. Front Endocrinol (Lausanne) 10:936 (2019). PubMed: 32038491
  • Bu G  et al. Identification of a Novel Functional Corticotropin-Releasing Hormone (CRH2) in Chickens and Its Roles in Stimulating Pituitary TSHß Expression and ACTH Secretion. Front Endocrinol (Lausanne) 10:595 (2019). PubMed: 31555213
  • Romanò N  et al. Heterogeneity of Calcium Responses to Secretagogues in Corticotrophs From Male Rats. Endocrinology 158:1849-1858 (2017). PubMed: 28323954
View all Publications for this product

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-4 of 4 Abreviews or Q&A

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-ACTH antibody

Average
Abreviews
Abreviews
abreview image
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Medaka fish Tissue sections (Pituitary)
Antigen retrieval step
None
Permeabilization
Yes - 10 minutes in 0.3% Triton (diluted in 1X PBST))
Specification
Pituitary
Blocking step
Normal Goat Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C
Fixative
Paraformaldehyde
Read More

Muhammad Rahmad Royan

Verified customer

Submitted Apr 02 2020

Western blot abreview for Anti-ACTH antibody

Excellent
Abreviews
Abreviews
Application
Western blot
Sample
Pig Purified protein (brain)
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris)
Loading amount
10 µg
Specification
brain
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 22°C
Read More

Abcam user community

Verified customer

Submitted Oct 27 2015

Question

Dear All,
do you have any WB/IP images of your antibody AB74976?
If you do, can you please share with us these images?

Thanks in advance
kind regards

Read More

Abcam community

Verified customer

Asked on Feb 18 2013

Answer

Thank you for contacting us.

Unfortunately we do not have any images for sharing we however can provide 100% image discount, if customer tests the antibody and submit an image in the form of Abreview. Please let me know if you want an Abtrial code.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Abcam Scientific Support

Answered on Feb 18 2013

Question

Can you please help with the following enquiry?
I am wanting to purchase polyclonal antibodies to the synthetic ACTH (1-24):
ab74976 (antigen 1-39)
ab8906 (antigen 1-39 IgG)
ab2407 (antigen 1-24, whole serum)
ab75683 (antigen 1-39, IgG)
Can you offer an suggestions as to which one would be most appropriate for my application - I am wanting to bind the antibody to magnetic beads that have been coated with a second antibody which will work with a primary antibody of rabbit origin. I then want to be able to separate the isolated ACTH (1-39) and ACTH (1-24) and analyse by LCMS.
Your advice is much appreciated J

Kind regards,

Read More

Abcam community

Verified customer

Asked on Feb 04 2013

Answer

Thank you for contacting us.

You can use any antibody however we will not be able to provide details about the purity of isolated protein.

The antibody ab2407 is in whole antiserum which means the concentration is not available so the optimization of the IP dilution would be necessary for better results.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Abcam Scientific Support

Answered on Feb 04 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.