Overview

  • Product name

    Anti-Activin Receptor Type IA antibody [2E2C11]
    See all Activin Receptor Type IA primary antibodies
  • Description

    Mouse monoclonal [2E2C11] to Activin Receptor Type IA
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Activin Receptor Type IA aa 21-120. Expressed in E.coli.
    Sequence:

    MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF


    Database link: Q04771

  • Positive control

    • WB: Recombinant human Activin Receptor Type IA (aa 21-120) protein; Human Activin Receptor Type IA (aa 21-120)-hIgG-Fc-transfected HEK-293 cell lysate. IHC-P: Human ovarian cancer and endometrial cancer tissue. ICC/IF: HeLa cells. Flow cyt: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 57 kDa.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis.
  • Tissue specificity

    Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells.
  • Involvement in disease

    Defects in ACVR1 are a cause of fibrodysplasia ossificans progressiva (FOP) [MIM:135100]. FOP is a rare autosomal dominant disorder of skeletal malformations and progressive extraskeletal ossification. Heterotopic ossification in FOP begins in childhood and can be induced by trauma or may occur without warning. Bone formation is episodic and progressive, leading to extra-articular ankylosis of all major joints of the axial and appendicular skeleton, rendering movement impossible.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activin A receptor type I antibody
    • Activin A receptor type II like kinase 2 antibody
    • Activin receptor type I antibody
    • Activin receptor type-1 antibody
    • Activin receptor-like kinase 2 antibody
    • ACTR-I antibody
    • ACTRI antibody
    • Acvr1 antibody
    • ACVR1_HUMAN antibody
    • ACVR1A antibody
    • ACVRLK2 antibody
    • ALK 2 antibody
    • ALK-2 antibody
    • ALK2 antibody
    • FOP antibody
    • Hydroxyalkyl protein kinase antibody
    • Serine/threonine-protein kinase receptor R1 antibody
    • SKR1 antibody
    • TGF-B superfamily receptor type I antibody
    • TGFB superfamily receptor type I antibody
    • TSR-I antibody
    • TSRI antibody
    see all

Images

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Activin Receptor Type IA with ab233716 at 1/200 dilution (green) compared with a negative control (red).

  • Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716) at 1/500 dilution + Recombinant human Activin Receptor Type IA (aa 21-120) protein

    Developed using the ECL technique.

    Predicted band size: 57 kDa



    Expected MW is 37 kDa.

  • All lanes : Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : Human Activin Receptor Type IA (aa 21-120)-hIgG-Fc-transfected HEK-293 cell lysate

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • Paraffin-embedded human ovarian cancer tissue stained for Activin Receptor Type IA using ab233716 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human endometrial cancer tissue stained for Activin Receptor Type IA using ab233716 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Activin Receptor Type I (green) using ab233716 at 1/200 dilution in ICC/IF. Actin is stained with AlexaFluor®-555-Phalloidin. Blue: DRAQ5 DNA dye.

References

ab233716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up