Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Activin Receptor Type IA antibody [2E2C11]
See all Activin Receptor Type IA primary antibodies -
Description
Mouse monoclonal [2E2C11] to Activin Receptor Type IA -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant fragment corresponding to Human Activin Receptor Type IA aa 21-120. Expressed in E.coli.
Sequence:MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
Database link: Q04771 -
Positive control
- WB: Recombinant human Activin Receptor Type IA (aa 21-120) protein; Human Activin Receptor Type IA (aa 21-120)-hIgG-Fc-transfected HEK-293 cell lysate. IHC-P: Human ovarian cancer and endometrial cancer tissue. ICC/IF: HeLa cells. Flow cyt: HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
2E2C11 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233716 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 57 kDa. | |
IHC-P | 1/200 - 1/1000. | |
Flow Cyt | 1/200 - 1/400. | |
ICC/IF | 1/200 - 1/1000. |
Target
-
Function
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis. -
Tissue specificity
Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. -
Involvement in disease
Defects in ACVR1 are a cause of fibrodysplasia ossificans progressiva (FOP) [MIM:135100]. FOP is a rare autosomal dominant disorder of skeletal malformations and progressive extraskeletal ossification. Heterotopic ossification in FOP begins in childhood and can be induced by trauma or may occur without warning. Bone formation is episodic and progressive, leading to extra-articular ankylosis of all major joints of the axial and appendicular skeleton, rendering movement impossible. -
Sequence similarities
Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
Contains 1 GS domain.
Contains 1 protein kinase domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 90 Human
- Entrez Gene: 11477 Mouse
- Entrez Gene: 79558 Rat
- Omim: 102576 Human
- SwissProt: Q28041 Cow
- SwissProt: Q04771 Human
- SwissProt: P37172 Mouse
- SwissProt: P80201 Rat
see all -
Alternative names
- Activin A receptor type I antibody
- Activin A receptor type II like kinase 2 antibody
- Activin receptor type I antibody
see all
Images
-
Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Activin Receptor Type IA with ab233716 at 1/200 dilution (green) compared with a negative control (red).
-
Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716) at 1/500 dilution + Recombinant human Activin Receptor Type IA (aa 21-120) protein
Developed using the ECL technique.
Predicted band size: 57 kDaExpected MW is 37 kDa.
-
All lanes : Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716) at 1/500 dilution
Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
Lane 2 : Human Activin Receptor Type IA (aa 21-120)-hIgG-Fc-transfected HEK-293 cell lysate
Developed using the ECL technique.
Predicted band size: 57 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716)
Paraffin-embedded human ovarian cancer tissue stained for Activin Receptor Type IA using ab233716 at 1/200 dilution in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716)
Paraffin-embedded human endometrial cancer tissue stained for Activin Receptor Type IA using ab233716 at 1/200 dilution in immunohistochemical analysis. DAB staining.
-
Immunocytochemistry/ Immunofluorescence - Anti-Activin Receptor Type IA antibody [2E2C11] (ab233716)
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Activin Receptor Type I (green) using ab233716 at 1/200 dilution in ICC/IF. Actin is stained with AlexaFluor®-555-Phalloidin. Blue: DRAQ5 DNA dye.
Datasheets and documents
References
ab233716 has not yet been referenced specifically in any publications.