Overview

  • Product name

    Anti-Activin Receptor Type IIA/ACVR2A antibody
    See all Activin Receptor Type IIA/ACVR2A primary antibodies
  • Description

    Rabbit polyclonal to Activin Receptor Type IIA/ACVR2A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Cow, Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Cow Activin Receptor Type IIA/ACVR2A aa 192-325. (Expressed in E.coli).
    Sequence:

    LQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGM KHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCH IAETMARGLAYLHEDIPGLKDGHKPAISHRDIKS


    Database link: Q28043

  • Positive control

    • WB: Cow skeletal muscle lysate; HepG2 cell lysate; Recombinant cow Activin Receptor Type IIA/ACVR2A protein.
  • General notes

     This product was previously labelled as Activin Receptor Type IIA

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 58 kDa.

Target

Images

  • Anti-Activin Receptor Type IIA/ACVR2A antibody (ab231057) at 2 µg/ml + Recombinant cow Activin Receptor Type IIA/ACVR2A protein

    Predicted band size: 58 kDa

  • Anti-Activin Receptor Type IIA/ACVR2A antibody (ab231057) at 1 µg/ml + Cow skeletal muscle lysate

    Predicted band size: 58 kDa

  • Anti-Activin Receptor Type IIA/ACVR2A antibody (ab231057) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 58 kDa

References

ab231057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up