Overview

  • Product name

  • Description

    Rabbit polyclonal to ACTL6A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human ACTL6A aa 201-250.
    Sequence:

    FITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSW


    Database link: O96019

  • Positive control

    • Human skin tissue; HUVEC cells; Jurkat and COLO205 cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.88% Sodium chloride, 50% Glycerol

    PBS without Mg2+, Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 20 µg/ml.
ICC/IF 1/100 - 1/500.

Target

  • Function

    Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for maximal ATPase activity of SMARCA4/BRG1/BAF190A and for association of the SMARCA4/BRG1/BAF190A containing remodeling complex BAF with chromatin/nuclear matrix. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and is required for the proliferation of neural progenitors. During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity). Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. Putative core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
  • Sequence similarities

    Belongs to the actin family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 53 kDa BRG1 associated factor A antibody
    • 53 kDa BRG1-associated factor A antibody
    • ACL6A_HUMAN antibody
    • Actin like 6A antibody
    • Actin like protein 6A antibody
    • Actin related protein 4 antibody
    • Actin related protein antibody
    • Actin related protein Baf53a antibody
    • Actin-like protein 6A antibody
    • Actin-related protein Baf53a antibody
    • ACTL 6 antibody
    • ACTL 6A antibody
    • ACTL6 antibody
    • ACTL6A antibody
    • Arp4 antibody
    • ARPN BETA antibody
    • ArpNbeta antibody
    • BAF 53A antibody
    • BAF complex 53 kDa subunit antibody
    • BAF53 antibody
    • BAF53A antibody
    • BRG1 associated factor antibody
    • BRG1-associated factor 53A antibody
    • hArpN beta antibody
    • INO80 complex subunit K antibody
    • INO80K antibody
    • MGC5382 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue, labeling ACTL6A with ab189315 at 20 µg/ml.

  • All lanes : Anti-ACTL6A antibody (ab189315) at 1/500 dilution

    Lane 1 : Jurkat cell extracts
    Lane 2 : COLO205 cell extracts
    Lane 3 : Cell extracts treated with synthesized peptide.

    Predicted band size: 47 kDa

  • Immunofluorescent analysis of HUVEC cells labeling ACTL6A with ab189315 at 1/100 dilution. The picture on the right is treated with the synthesized peptide.

References

ab189315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up