Overview

  • Product name

  • Description

    Rabbit polyclonal to ACTL7B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human ACTL7B aa 1-97.
    Sequence:

    MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIK AVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL


    Database link: Q9Y614

  • Positive control

    • WB: HEK-293T overexpressing ACTL7B cell lysate. IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 45 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Detected only in the testis and, to a lesser extent, in the prostate.
  • Sequence similarities

    Belongs to the actin family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACL7B_HUMAN antibody
    • Actin like 7 beta antibody
    • Actin like 7B antibody
    • Actin like protein 7B antibody
    • Actin-like protein 7B antibody
    • Actin-like-7-beta antibody
    • ACTL7B antibody
    • MGC151192 antibody
    • MGC151194 antibody
    • OTTHUMP00000021867 antibody
    • OTTMUSP00000007742 antibody
    • RP11-3J11.2 antibody
    • RP23-48F4.1 antibody
    • t actin 1 antibody
    • Tact1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for ACTL7B using ab223716 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-ACTL7B antibody (ab223716) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate (negative control)
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) overexpressing ACTL7B (co-expressed with a c-terminal myc-DDK tag), cell lysate

    Predicted band size: 45 kDa

References

ab223716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up