Overview

  • Product name

    Anti-ACTL9 antibody
  • Description

    Rabbit polyclonal to ACTL9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ACTL9 aa 1-160.
    Sequence:

    MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTG VVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGE AARVLPELTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSD PPFSPATNRE


    Database link: Q8TC94

  • Positive control

    • ICC/IF: HepG2 and MCF7 cells. IHC-P: Human kidney tissue. WB: Mouse heart and skeletal muscle tissue lysates.
  • General notes

     This product was previously labelled as MGC33407

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Detects a band of approximately 35,46 kDa (predicted molecular weight: 46 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-ACTL9 antibody (ab229876) at 1/2000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse skeletal muscle tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 46 kDa
    Observed band size: 35,46 kDa
    why is the actual band size different from the predicted?

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ACTL9 using ab229876 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • MCF7 (human breast adenocarcinoma cell line) cells stained for ACTL9 using ab229876 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for ACTL9 using ab229876 at 1/100 dilution in immunohistochemical analysis.

References

ab229876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up