Overview

  • Product name

    Anti-ACTR8 antibody - N-terminal
  • Description

    Rabbit polyclonal to ACTR8 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human ACTR8 aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV


    Database link: NP_075050.3

  • Positive control

    • Jurkat whole cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177335 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 70 kDa.

Target

  • Function

    Plays an important role in the functional organization of mitotic chromosomes. Exhibits low basal ATPase activity, and unable to polymerize.
    Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA reoplication and probably DNA repair. Required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage. Strongly prefer nucleosomes and H3-H4 tetramers over H2A-H2B dimers, suggesting it may act as a nucleosome recognition module within the complex.
  • Sequence similarities

    Belongs to the actin family. ARP8 subfamily.
  • Cellular localization

    Nucleus. Chromosome. Specifically localizes to mitotic chromosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Actin-related protein 8 antibody
    • Actr8 antibody
    • ARP8_HUMAN antibody
    • hArp8 antibody
    • INO80 complex subunit N antibody
    see all

Images

  • Anti-ACTR8 antibody - N-terminal (ab177335) at 1 µg/ml + Jurkat whole cell lysate at 10 µg

    Predicted band size: 70 kDa



    5% milk block used

References

ab177335 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177335.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up