Overview

  • Product name

  • Description

    Rabbit polyclonal to ACY3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Fusion protein corresponding to Human ACY3 aa 1-319. Full length fusion protein. The protein fusion partner is GST.
    Sequence:

    MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVP VLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLL GPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPEL SCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVA TVLDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDR DFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEK FTFTVPAMPALTPAPSPAS


    Database link: Q96HD9

  • Positive control

    • Mouse kidney tissue lysate; Human cervical cancer tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab197799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/25 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.

Target

  • Function

    Plays an important role in deacetylating mercapturic acids in kidney proximal tubules.
  • Sequence similarities

    Belongs to the AspA/AstE family. Aspartoacylase subfamily.
  • Cellular localization

    Apical cell membrane. Cytoplasm. Predominantly localized in the apical membrane of cells in the S1 segment. In the proximal straight tubules (S2 and S3 segments) is expressed diffusely throughout the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • AA3 antibody
    • ACY-3 antibody
    • acy3 antibody
    • ACY3_HUMAN antibody
    • Acylase III antibody
    • Aminoacylase 3 antibody
    • Aminoacylase III antibody
    • Aminoacylase-3 antibody
    • ASPA2 antibody
    • Aspartoacylase (aminoacylase) 3 antibody
    • Aspartoacylase 2 antibody
    • Aspartoacylase-2 antibody
    • AW107362 antibody
    • EC 3.5.1.- antibody
    • EC 3.5.1.15 antibody
    • HCBP1 antibody
    • Hepatitis C virus core binding protein 1 antibody
    • Hepatitis C virus core-binding protein 1 antibody
    see all

Images

  • Anti-ACY3 antibody (ab197799) at 1/500 dilution + mouse kidney tissue lysate at 40 µg

    Predicted band size: 35 kDa


    Exposure time: 5 seconds


    Gel: 10%SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue, labeling ACY3 with ab197799 at 1/25 dilution.

References

ab197799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up