Overview

  • Product name

    Anti-Acyloxyacyl Hydrolase antibody
    See all Acyloxyacyl Hydrolase primary antibodies
  • Description

    Rabbit polyclonal to Acyloxyacyl Hydrolase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Acyloxyacyl Hydrolase aa 24-300. (Expressed in E.coli).
    Sequence:

    SPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLCSYL PEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLC HLYPLPKETWKFTLQKARQIVKKSPILKYSRSGSDICSLPVLAKICQKIK LAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWD VHQDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPE WITASQMSLNSFINLPTALTNELDWPQ


    Database link: P28039

  • Positive control

    • IHC-P: Human appendix, breast cancer, prostate cancer, glioma, liver and stomach tissues. WB: Human serum; Pig stomach, small intestine and spleen lysates; Recombinant human Acyloxyacyl Hydrolase protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 20 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Removes the secondary (acyloxyacyl-linked) fatty acyl chains from the lipid A region of bacterial lipopolysaccharides.
  • Sequence similarities

    Contains 1 saposin B-type domain.
  • Post-translational
    modifications

    Both subunits contain a number of cysteine residues that may form disulfide bridges.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acyloxyacyl hydrolase (neutrophil) antibody
    • Acyloxyacyl hydrolase large subunit antibody
    • AOAH antibody
    • AOAH_HUMAN antibody

Images

  • Paraffin-embedded human appendix tissue stained for Acyloxyacyl Hydrolase using ab233405 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for Acyloxyacyl Hydrolase using ab233405 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Acyloxyacyl Hydrolase using ab233405 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Acyloxyacyl Hydrolase using ab233405 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for Acyloxyacyl Hydrolase using ab233405 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for Acyloxyacyl Hydrolase using ab233405 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Acyloxyacyl Hydrolase antibody (ab233405) at 2 µg/ml + Recombinant human Acyloxyacyl Hydrolase protein

    Predicted band size: 65 kDa

  • Anti-Acyloxyacyl Hydrolase antibody (ab233405) at 2 µg/ml + Pig stomach lysate

    Predicted band size: 65 kDa

  • Anti-Acyloxyacyl Hydrolase antibody (ab233405) at 2 µg/ml + Human serum

    Predicted band size: 65 kDa

  • Anti-Acyloxyacyl Hydrolase antibody (ab233405) at 2 µg/ml + Pig small intestine lysate

    Predicted band size: 65 kDa

  • Anti-Acyloxyacyl Hydrolase antibody (ab233405) at 2 µg/ml + Pig spleen lysate

    Predicted band size: 65 kDa

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Acyloxyacyl Hydrolase using ab233405 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab233405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up