Overview

  • Product name

  • Description

    Rabbit polyclonal to ACYP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Guinea pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse ACYP2 aa 2-106. (Expressed in E.coli).
    Sequence:

    LLGRRLAAMTELLKSVDYEVFGTVQGVCFRMYTEGEAKKRGLVGWVKNTS KGTVTGQVQGPEEKVDAMKSWLSKVGSPSSRIDRADFSNEKTISKLEYSD FSIRY


    Database link: P56375

  • Positive control

    • IHC-P: Mouse kidney tissue. WB: Mouse skeletal muscle lysate; recombinant mouse ACYP2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab230997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 12 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Its physiological role is not yet clear.
  • Sequence similarities

    Belongs to the acylphosphatase family.
    Contains 1 acylphosphatase-like domain.
  • Information by UniProt
  • Database links

  • Form

    Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. Cellular localisation mitochodrion according to entrez gene.
  • Alternative names

    • Acylphosphatase 2 antibody
    • Acylphosphatase 2 muscle type antibody
    • Acylphosphatase antibody
    • Acylphosphatase muscle type isozyme antibody
    • Acylphosphatase-2 antibody
    • Acylphosphatase2 antibody
    • Acylphosphate phosphohydrolase 2 antibody
    • Acylphosphate phosphohydrolase antibody
    • ACYM antibody
    • ACYP 2 antibody
    • ACYP antibody
    • Acyp2 antibody
    • ACYP2_HUMAN antibody
    • Muscle type acylphosphatase 2 antibody
    • muscle type isozyme antibody
    see all

Images

  • Paraffin-embedded mouse kidney tissue stained for ACYP2 using ab230997 at 20 µg/ml in immunohistochemical analysis.

  • Anti-ACYP2 antibody (ab230997) at 2 µg/ml + Mouse skeletal muscle lysate

    Predicted band size: 12 kDa

  • Anti-ACYP2 antibody (ab230997) at 2 µg/ml + Recombinant mouse ACYP2 protein

    Predicted band size: 12 kDa

References

ab230997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up