Overview

  • Product name

  • Description

    Rabbit polyclonal to ACYP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Pig
  • Immunogen

    Recombinant fragment corresponding to Human ACYP2 aa 28-87.
    Sequence:

    EDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRID RTNFSNEKTI


    Database link: P14621

  • Positive control

    • IHC-P: Human cervical cancer tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • Paraffin-embedded human cervical cancer tissue stained for ACYP2 using ab234636 at 1/100 dilution in immunohistochemical analysis.

  • U-251 MG (human brain glioma cell line) cells stained for ACYP2 (green) using ab234636 at 1/100 dilution in ICC/IF, followed by Alexa-Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up