For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ada-antibody-ab175310.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Chromatin Modifying Enzymes Deamination
Share by email

Anti-ADA antibody (ab175310)

  • Datasheet
  • SDS
Reviews (1) Submit a question References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-ADA antibody (ab175310)

    Key features and details

    • Rabbit polyclonal to ADA
    • Suitable for: ICC/IF
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant human ADA protein (ab109839)
    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-ADA antibody
      See all ADA primary antibodies
    • Description

      Rabbit polyclonal to ADA
    • Host species

      Rabbit
    • Tested applications

      Suitable for: ICC/IFmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Cow
    • Immunogen

      Recombinant full length protein corresponding to Human ADA aa 1-363.
      Sequence:

      MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVI GMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEV RYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARS ILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQA YQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYN RLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKA YGMPPSASAGQNL


      Database link: P00813
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • General notes

      The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

      If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.30
      Preservative: 0.02% Sodium azide
      Constituents: 50% Glycerol, 49% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Epigenetics and Nuclear Signaling
      • Chromatin Modifying Enzymes
      • Deamination
      • Cancer
      • Cancer Metabolism
      • Response to hypoxia
      • Metabolism
      • Pathways and Processes
      • Metabolism processes
      • Hypoxia

    Associated products

    • Assay kits

      • Adenosine Deaminase (ADA) Activity Assay Kit (Fluorometric) (ab204695)
    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Positive Controls

      • Recombinant human ADA protein (ab109839)
      • HeLa whole cell lysate (ab150035)
      • HeLa whole cell lysate (ab29545)
      • Jurkat whole cell lysate (ab30128)
      • Jurkat whole cell lysate (ab7899)
    • Recombinant Protein

      • Recombinant human ADA protein (ab109839)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab175310 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    ICC/IF
    Use at an assay dependent concentration.
    Notes
    ICC/IF
    Use at an assay dependent concentration.

    Target

    • Function

      Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4. Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion.
    • Tissue specificity

      Found in all tissues, occurs in large amounts in T-lymphocytes and, at the time of weaning, in gastrointestinal tissues.
    • Involvement in disease

      Defects in ADA are the cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-negative/NK-cell-negative due to adenosine deaminase deficiency (ADASCID) [MIM:102700]. SCID refers to a genetically and clinically heterogeneous group of rare congenital disorders characterized by impairment of both humoral and cell-mediated immunity, leukopenia, and low or absent antibody levels. Patients with SCID present in infancy with recurrent, persistent infections by opportunistic organisms. The common characteristic of all types of SCID is absence of T-cell-mediated cellular immunity due to a defect in T-cell development. ADA-SCID is an autosomal recessive form accounting for about 50% of non-X-linked SCIDs. ADA deficiency has been diagnosed in chronically ill teenagers and adults (late or adult onset). Population and newborn screening programs have also identified several healthy individuals with normal immunity who have partial ADA deficiency.
    • Sequence similarities

      Belongs to the adenosine and AMP deaminases family.
    • Cellular localization

      Cell membrane. Cell junction. Cytoplasmic vesicle lumen. Cytoplasm. Colocalized with DPP4 at the cell junction in lymphocyte-epithelial cell adhesion.
    • Target information above from: UniProt accession P00813 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 100 Human
      • Omim: 608958 Human
      • SwissProt: P00813 Human
      • Unigene: 654536 Human
      • Alternative names

        • ada antibody
        • ADA_HUMAN antibody
        • ADA1 antibody
        • Adenosine aminohydrolase antibody
        • Adenosine deaminase antibody
        see all

      Images

      • Immunocytochemistry/ Immunofluorescence - Anti-ADA antibody (ab175310)
        Immunocytochemistry/ Immunofluorescence - Anti-ADA antibody (ab175310)
        Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab175310. Blue DAPI for nuclear staining.

      Protocols

      • Immunocytochemistry & immunofluorescence protocols

      Click here to view the general protocols

      Datasheets and documents

      • SDS download

      • Datasheet download

        Download

      References (2)

      Publishing research using ab175310? Please let us know so that we can cite the reference in this datasheet.

      ab175310 has been referenced in 2 publications.

      • Seiler KM  et al. Single-Cell Analysis Reveals Regional Reprogramming During Adaptation to Massive Small Bowel Resection in Mice. Cell Mol Gastroenterol Hepatol 8:407-426 (2019). PubMed: 31195149
      • Ye TS  et al. Repeated Electroacupuncture Persistently Elevates Adenosine and Ameliorates Collagen-Induced Arthritis in Rats. Evid Based Complement Alternat Med 2016:3632168 (2016). IHC . PubMed: 26941824

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      Flow Cytometry abreview for Anti-ADA antibody

      Good
      Abreviews
      Abreviews
      abreview image
      Application
      Flow Cytometry
      Sample
      Human Cell (Peripheral blood mononuclear cells from blood of h)
      Permeabilization
      No
      Gating Strategy
      single cells -> alive cells -> CD45+ -> CD14- -> CD3+ -> CD8+
      Specification
      Peripheral blood mononuclear cells from blood of h
      Preparation
      Cell harvesting/tissue preparation method: Isolation PBMC from blood, freezing, thawing for the staining
      Sample buffer: Thawing: medium. All washing steps: PBS + 0,1% BSA + 2mM EDTA. Staining (prim Abs only): BD brilliant stain buffer #563794
      Read More

      Abcam user community

      Verified customer

      Submitted Aug 01 2019

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.