Overview

  • Product name

    Anti-ADA2 antibody
  • Description

    Rabbit polyclonal to ADA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Saccharomyces cerevisiae ADA2 aa 1-434. Recombinant protein produced in E. coli.
    Sequence:

    MSNKFHCDVCSADCTNRVRVSCAICPEYDLCVPCFSQGSYTGKHRPYHDY RIIETNSYPILCPDWGADEELQLIKGAQTLGLGNWQDIADHIGSRGKEEV KEHYLKYYLESKYYPIPDITQNIHVPQDEFLEQRRHRIESFRERPLEPPR KPMASVPSCHEVQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDIEL KFAILDIYNSRLTTRAEKKRLLFENHLMDYRKLQAIDKKRSKEAKELYNR IKPFARVMTAQDFEEFSKDILEELHCRARIQQLQEWRSNGLTTLEAGLKY ERDKQARISSFEKFGASTAASLSEGNSRYRSNSAHRSNAEYSQNYSENGG RKKNMTISDIQHAPDYALLSNDEQQLCIQLKILPKPYLVLKEVMFRELLK TGGNLSKSACRELLNIDPIKANRIYDFFQSQNWM


    Database link: Q02336

  • Positive control

    • WB; whole cell extract of S. cerevisiae.

Properties

Applications

Our Abpromise guarantee covers the use of ab215524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000.

Target

  • Relevance

    Functions as component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA and ADA. SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3 and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SALSA, an altered form of SAGA, may be involved in positive transcriptional regulation. SLIK is proposed to have partly overlapping functions with SAGA. It preferentially acetylates methylated histone H3, at least after activation at the GAL1-10 locus. ADA preferentially acetylates nucleosomal histones H3 (to form H3K14ac and H3K18ac) and H2B.
  • Database links

    • Alternative names

      • D9461.33 antibody
      • SWI8 antibody
      • Transcriptional adapter 2 antibody
      • YDR448W antibody

    Images

    • Anti-ADA2 antibody (ab215524) at 1/500 dilution + S. cerevisiae whole cell extract

      Secondary
      HRP-conjugated goat anti-rabbit IgG at 1/10000 dilution

    References

    ab215524 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab215524.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up