Overview

  • Product name

    Anti-ADA2a antibody - N-terminal
  • Description

    Rabbit polyclonal to ADA2a - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ADA2a aa 1-67 (N terminal).
    Sequence:

    MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF EYKKHQSDHTYEIMTSD


    Database link: O75478

  • Positive control

    • ICC/IF: SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    Many DNA binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. ADA2a is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex.
  • Cellular localization

    Nuclear, Chromosome
  • Database links

  • Alternative names

    • ADA2 ALPHA antibody
    • ADA2 antibody
    • ADA2 like antibody
    • ADA2 like protein antibody
    • ADA2, yeast, homolog of, alpha antibody
    • ADA2A antibody
    • hADA2 antibody
    • KL04P antibody
    • Tada2l antibody
    • Transcriptional adapter 2 alpha antibody
    • Transcriptional adapter 2 like antibody
    • Transcriptional adaptor 2 (ADA2 homolog, yeast) like antibody
    • Transcriptional adaptor 2 (ADA2, yeast, homolog) like antibody
    • Transcriptional adaptor 2 alpha antibody
    • Transcriptional adaptor 2A antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for ADA2a (green) using ab222309 at 4 µg/ml in ICC/IF.

References

ab222309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up