Overview

  • Product name

    Anti-ADAM15 antibody [6D34]
    See all ADAM15 primary antibodies
  • Description

    Rat monoclonal [6D34] to ADAM15
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse ADAM15. Immunized with mouse recombinant protein of A Disintegrin and ADAM15 ectodomain.
    Sequence:

    RPSPPLPNIGGTEEEQQASPERTLSGSMESRVVQDSPPMSLADVLQTGLP EALRISLELDSESHVLELLQNRDLIPGRPTLVWYQPDGTRMVSEGYSLEN CCYRGRVQGHPSSWVSLCACSGIRGLIVLSPERGYTLELGPGDLQRPVIS RIQDHLLLGHTCAPSWHASVPTRAGPDLLLEQHHAHRLKRDVVTETKIVE LVIVADNSEVRKYPDFQQLLNRTLEAALLLDTFFQPLNVRVALVGLEAWT QHNLIEMSSNPAVLLDNFLRWRRTDLLPRLPHDSAQLVTVTSFSGPMVGM AIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDSPGHSCP CPGPAPAKSCIMEASTDFLPGLNFSNCSRQALEKALLEGMGSCLFERQPS LAPMSSLCGNMFVDPGEQCDCGFDECTDPCCDHFTCQLRPGAQCASDGPC CQNCKLHPAGWLCRPPTDDCDLPEFCPGDSSQCPSDIRLGDGEPCASGEA VCMHGRCASYARQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRSPGGS YMPCAPRDVMCGQLQCQWGRSQPLLGSVQDRLSEVLEANGTQLNCSWVDL DLGNDVAQPLLALPGTACGPGLVCIGHRCQPVDLLGAQECRRKCHGHGVC DSSGHCRCEEGWAPPDCMTQLKATS


    Database link: O88839

Properties

Applications

Our Abpromise guarantee covers the use of ab194610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 93 kDa.

Target

  • Function

    Active metalloproteinase with gelatinolytic and collagenolytic activity. Plays a role in the wound healing process. Mediates both heterotypic intraepithelial cell/T-cell interactions and homotypic T-cell aggregation. Inhibits beta-1 integrin-mediated cell adhesion and migration of airway smooth muscle cells. Suppresses cell motility on or towards fibronectin possibly by driving alpha-v/beta-1 integrin (ITAGV-ITGB1) cell surface expression via ERK1/2 inactivation. Cleaves E-cadherin in response to growth factor deprivation. Plays a role in glomerular cell migration. Plays a role in pathological neovascularization. May play a role in cartilage remodeling. May be proteolytically processed, during sperm epididymal maturation and the acrosome reaction. May play a role in sperm-egg binding through its disintegrin domain.
  • Tissue specificity

    Expressed in colon and small intestine. Expressed in airway smooth muscle and glomerular mesangial cells (at protein level). Ubiquitously expressed. Overexpressed in atherosclerotic lesions. Constitutively expressed in cultured endothelium and smooth muscle. Expressed in chondrocytes. Expressed in airway smooth muscle and glomerular mesangial cells.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 EGF-like domain.
    Contains 1 peptidase M12B domain.
  • Domain

    The cytoplasmic domain interacts with endophilin I and sorting nexin 9.
    Disintegrin domain binds to integrin alphaV-beta3.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
    Phosphorylation increases association with PTKs.
  • Cellular localization

    Endomembrane system. Cell junction > adherens junction. Cell projection > cilium > flagellum. Cytoplasmic vesicle > secretory vesicle > acrosome. The majority of the protein is localized in a perinuclear compartment which may correspond to the trans-Golgi network or the late endosome. The pro-protein is the major detectable form on the cell surface, whereas the majority of the protein in the cell is processed.
  • Information by UniProt
  • Database links

  • Alternative names

    • A disintegrin and metalloproteinase domain 15 (metargidin) antibody
    • A disintegrin and metalloproteinase domain 15 antibody
    • ADA15_HUMAN antibody
    • ADAM 15 antibody
    • ADAM metallopeptidase domain 15 antibody
    • Adam15 antibody
    • and cysteine-rich protein 15 antibody
    • Disintegrin and metalloproteinase domain-containing protein 15 antibody
    • disintegrin-like antibody
    • EC 3.4.24. antibody
    • MDC 15 antibody
    • MDC-15 antibody
    • MDC15 antibody
    • Metalloprotease RGD disintegrin protein antibody
    • Metalloproteinase like disintegrin like and cysteine rich protein 15 antibody
    • Metalloproteinase-like antibody
    • Metargidin antibody
    see all

References

ab194610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up