Overview

  • Product name

    Anti-ADAM19 antibody [11J23]
    See all ADAM19 primary antibodies
  • Description

    Rat monoclonal [11J23] to ADAM19
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse ADAM19. A recombinant protein of A Disintegrin and ADAM19 ectodomain
    Sequence:

    EDLHSMKYVELYLVADYAEFQKNRHDQDATKRKLMEIANYVDKFYRSLNI RIALVGLEVWTHGDKCEVSENPYSTLWSFLSWRRKLLAQKSHDNAQLITG RSFQGTTIGLAPLMAMCSVYQSGGVSMDHSENAIGVASTVAHEIGHNFGM SHDSAHCCSASAADGGCIMAAATGHPFPKVFSWCNRKELDRYLQTGGGMC LSNMPDTRTLYGGRRCGNGYLEDGEECDCGEEEECKNPCCNASNCTLKEG AECAHGSCCHQCKLVAPGTQCREQVRQCDLPEFCTGKSPHCPTNYYQMDG TPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPALDLCFERVNAAGDTYGN CGKGLNGQYRKCSPRDAKCGKIQCQSTQARPLESNAVSIDTTITLNGRRI HCRGTHVYRGPEEEEGEGDMLDPGLVMTGTKCGHNHICFEGQCRNTSFFE TEGCGKKCNGHGVCNNNKNCHCFPGWSPPFCNTPGDGGSVDSGPLPPKSV


    Database link: O35674

Properties

Applications

Our Abpromise guarantee covers the use of ab194619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 101 kDa.

Target

  • Relevance

    ADAM19, is a member of the ADAM (a disintegrin and metalloprotease-like domain) family. It has been cloned from mouse and human. ADAM19 was first described in muscle cells as a protein with homology to the fertilins (ADAMs 1 and 2). Initial observations indicated a role for ADAM19 in myoblast fusion, similar to sperm-egg fusion aided by ADAMs 1 and 2. Later works describe ADAM19 in the bone, muscle, lung, heart, brain, kidney, and a wide range of tissues. The Cytoplasmic domain of ADAM19, like ADAMs 9, 12 and 15, contains SH3 ligand domains, which are thought to interact with PKC-d, suggesting specific regulation routes for ADAM19. Also reported is a sequence of ADAM19 lacking the transmembrane and cytoplasmic domains, suggesting that a soluble form is produced. ADAM-19 contains the canonical HExxHxxxxxH zinc metalloproteinase motif, and has been shown to be proteolytically active. Other ADAMs family members (ADAM-10, ADAM-17) have been more thoroughly studied, and are known to play key roles in inflammation, growth factor maturation and release, and a wide range of other functions. The full length ADAM19 sequence codes for a 956 amino acid protein, containing a Type-I transmembrane domain, with a predicted mass is 105 kD. Two shorter sequences have been reported: a 918 amino acid sequence that differs at the carboxyterminal end, and the soluble form, a 538 amino acid version with predicted mass of 59.9 kD. Mouse ADAM19 sequence is 920 AA, predicted at 100.86 kD.
  • Cellular localization

    Cell Membrane. Type I membrane protein.
  • Database links

  • Alternative names

    • A disintegrin and metalloproteinase domain 19 (meltrin beta) antibody
    • A disintegrin and metalloproteinase domain 19 antibody
    • ADAM 19 antibody
    • ADAM metallopeptidase domain 19 antibody
    • Disintegrin and metalloproteinase domain containing protein 19 antibody
    • FKSG 34 antibody
    • FKSG34 antibody
    • MADDAM antibody
    • Meltrin beta antibody
    • Metalloprotease and disintegrin dentritic antigen marker antibody
    • Metalloprotease disintegrin meltrin beta antibody
    • MLTN B antibody
    • MLTNB antibody
    see all

References

ab194619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up