Overview

  • Product name

  • Description

    Rabbit polyclonal to ADAM23
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ADAM23 aa 47-165.
    Sequence:

    LLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQN SSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAV HLAQASFQIEAFGSKFILD


    Database link: O75077

  • Positive control

    • IHC-P: Human rectum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    ADAM23 is a non-catalytic metalloprotease-like protein. It is highly expressed in the brain, primarily in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole, and weakly expressed in the heart. 3 isoforms are produced by alternative splicing, alpha, beta and gamma. ADAM23 may play a role in cell-cell and cell-matrix interactions.
  • Cellular localization

    Single pass type I membrane protein. 3 isoforms produced by alternative splicing, gamma isoform is secreted.
  • Database links

  • Alternative names

    • A disintegrin and metalloproteinase domain 23 antibody
    • ADAM metallopeptidase domain 23 antibody
    • Disintegrin and metalloproteinase domain containing protein 23 antibody
    • MDC 3 antibody
    • MDC3 antibody
    • Metalloproteinase like disintegrin like and cysteine rich protein 3 antibody
    see all

Images

  • Paraffin embedded human rectum tissue stained for ADAM23 with ab224088 (1/20 dilution) in immunohistochemical analysis.

References

ab224088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up