Overview

  • Product name

    Anti-ADAMTS1 antibody [OTI1B4]
    See all ADAMTS1 primary antibodies
  • Description

    Mouse monoclonal [OTI1B4] to ADAMTS1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ADAMTS1 aa 412-644. Produced in E.coli (NP_008919).
    Sequence:

    DDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGE CLMDKPQNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWC TGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHGS WGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLE DCPDNNGKTFREEQCEAHNEFSKASFGSGPAVE


    Database link: Q9UHI8

  • Positive control

    • WB: pCMV6-ENTRY ADAMTS1 cDNA transfected HEK-293T cell lysate.
  • General notes

    Clone OTI1B4 (formerly 1B4).

Properties

Applications

Our Abpromise guarantee covers the use of ab236497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 105 kDa.

Target

  • Function

    Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover (By similarity). Has angiogenic inhibitor activity. Active metalloprotease, which may be associated with various inflammatory processes as well as development of cancer cachexia. May play a critical role in follicular rupture.
  • Sequence similarities

    Contains 1 disintegrin domain.
    Contains 1 peptidase M12B domain.
    Contains 3 TSP type-1 domains.
  • Domain

    The spacer domain and the TSP type-1 domains are important for a tight interaction with the extracellular matrix.
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications

    The precursor is cleaved by a furin endopeptidase.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • A disintegrin and metalloproteinase with thrombospondin motifs 1 antibody
    • ADAM-TS 1 antibody
    • ADAM-TS1 antibody
    • ADAMTS 1 antibody
    • ADAMTS antibody
    • ADAMTS-1 antibody
    • Adamts1 antibody
    • ATS1_HUMAN antibody
    • C3 C5 antibody
    • KIAA1346, antibody
    • METH 1 antibody
    • METH-1 antibody
    see all

Images

  • All lanes : Anti-ADAMTS1 antibody [OTI1B4] (ab236497) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY ADAMTS1 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 105 kDa

References

ab236497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up